KEGG   Micropruina glycogenica: MPLG2_3678Help
Entry
MPLG2_3678        CDS       T05338                                 

Gene name
proC
Definition
(GenBank) Pyrroline-5-carboxylate reductase
  KO
K00286  pyrroline-5-carboxylate reductase [EC:1.5.1.2]
Organism
mgg  Micropruina glycogenica
Pathway
mgg00330  Arginine and proline metabolism
mgg01100  Metabolic pathways
mgg01110  Biosynthesis of secondary metabolites
mgg01130  Biosynthesis of antibiotics
mgg01230  Biosynthesis of amino acids
Module
mgg_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:mgg00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    MPLG2_3678 (proC)
Enzymes [BR:mgg01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.2  pyrroline-5-carboxylate reductase
     MPLG2_3678 (proC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: P5CR_dimer F420_oxidored NAD_binding_2 ApbA Sacchrp_dh_NADP NAD_Gly3P_dh_N 3HCDH_N Shikimate_DH PDH TrkA_N 3HCDH_RFF SAP130_C
Motif
Other DBs
NCBI-ProteinID: SPD88708
UniProt: A0A2N9JM97
LinkDB All DBs
Position
1:3586501..3587310
Genome map
AA seq 269 aa AA seqDB search
MTRLAVIGAGVMGEALVSGLLRGGWSSDDIVVADRREFRRAEMTAAHGIAAAEHNADAAA
QADTVILVVKPQDVPAVLPDIAPVLRPGTLLVSLCAGVTTKALESHLPAGTPVVRVMPNT
PALVSEGMAAVSAGSSASDDDVAHALELMQALGKAITVPEAYQDAVTAISGSGPAYLFFV
VEAMIDAGVMLGLPRDISTTLVNQTMFGSAKLLIESGQHPTVLREQVTSPGGTTAAALRQ
LEDHRVKAAFITAMEAARDRSRALAGPAT
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgacgcggttggccgtgatcggcgcgggcgtgatgggcgaggccctggtcagcgggttg
ctcaggggcggatggtcgtccgacgacatcgtggtggccgaccgtcgcgagtttcgccgg
gccgagatgacggccgcccacggcatcgcggccgccgagcacaacgccgacgccgccgcg
caggccgacacggtgattctggtggtcaagccgcaggacgtacctgccgtgctgcccgac
atcgccccggtgttgcgccccggcaccctgctggtgtcactgtgtgcgggcgtcaccacc
aaggcgctggagagccacctgcccgcaggcacgccggtcgtgcgggtgatgcccaacacc
ccggccctggtcagcgagggcatggccgcagtgtcggccggttcgagcgcgtccgacgac
gacgtggcccacgcgctggaactgatgcaggcactcggcaaggccatcactgtgccggag
gcctatcaggacgcggtcaccgccatctcgggttcgggccccgcgtacctgttcttcgtg
gtcgaagcgatgatcgacgccggcgtcatgctgggcctgccccgcgacatctcgaccacc
ctggtgaaccagaccatgttcggttcggcgaagctgctgatcgagtcgggccagcacccc
accgtgctgcgcgaacaggtgacctcgccgggtggcaccaccgcggcggcgctgcgccaa
ctggaggatcaccgggtgaaggcggccttcatcaccgccatggaggcggctcgcgaccgc
agccgcgcactggccggcccggccacctga

DBGET integrated database retrieval system