KEGG   Mycoplasma gallisepticum R(high): MGAH_0502Help
Entry
MGAH_0502         CDS       T01923                                 

Gene name
tdk
Definition
(GenBank) Thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
mgh  Mycoplasma gallisepticum R(high)
Pathway
mgh00240  Pyrimidine metabolism
mgh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mgh00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    MGAH_0502 (tdk)
Enzymes [BR:mgh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     MGAH_0502 (tdk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK
Motif
Other DBs
NCBI-ProteinID: ADC30882
LinkDB All DBs
Position
907007..907681
Genome map
AA seq 224 aa AA seqDB search
MAKKNAMTTTNGWIEAICGPMFAGKTDELIRKIKRYEYADVKSLVFSPATDTRSAQEIIN
SRDGRRIGSIKIKKAFEIYDYVLLHKPQLVGIDEVQFFDDSIVEVIQTLADNQINVIVAG
LDRDFRGEPFGPIPKILGIAESVIRLTAICSECGAEASRSQRLIDNQPADYNCETILIGD
TESYAPRCRHHHKVPNRPINDQTKNFKRALKNNFDKIVEQSSKD
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atggctaagaagaacgcaatgaccaccactaatggttgaatcgaagcaatttgtggtccg
atgtttgctggtaaaacagatgaactaattcgcaagattaaacgttatgagtatgctgat
gtaaagtcgttggtcttttcaccagcaactgatactcgttcagctcaagagattatcaac
tctcgagatgggcgtagaattggttcaataaagatcaaaaaagcatttgaaatctatgat
tatgttttattacataaaccacaattagttggaattgacgaagtgcaattctttgatgat
tcaattgttgaagtcatccaaacattagctgataaccaaattaacgtaattgtggctggt
ttagaccgtgattttagaggtgaaccttttggtccaattcctaagattttaggaattgca
gaatcagtaatccgcttaaccgcaatctgttctgagtgtggtgctgaagctagtcgaagt
caacgtttaattgataaccaaccagctgactacaattgcgaaacgattcttattggtgac
actgaatcatacgcgccaagatgtcgtcatcaccataaagtgcctaaccggccaattaac
gaccaaaccaagaacttcaaacgtgcactaaaaaataattttgataaaatagtagagcaa
tcttcaaaagattaa

DBGET integrated database retrieval system