KEGG   Mycolicibacterium gilvum PYR-GCK: Mflv_0125Help
Entry
Mflv_0125         CDS       T00498                                 

Definition
(GenBank) Alcohol dehydrogenase GroES domain protein
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
mgi  Mycolicibacterium gilvum PYR-GCK
Pathway
mgi00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:mgi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    Mflv_0125
Enzymes [BR:mgi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     Mflv_0125
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     Mflv_0125
    1.1.1.-  
     Mflv_0125
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_N_assoc ADH_zinc_N_2 Pyr_redox_3
Motif
Other DBs
NCBI-ProteinID: ABP42620
UniProt: A4T2Y8
LinkDB All DBs
Position
complement(112396..113448)
Genome map
AA seq 350 aa AA seqDB search
MRAAVYYGPNKLEVDDVPEPEARPGTVKLKVGFNGICGTDLHEYYAGPIFVPTAPHPLTG
AQLPLTMGHEFSGTITAVGDGVTGWQEGDRVAVEPIYKCDQCGPCRAGNYNVCQQIGFHG
LMSDGGMAEYTVVPTGMLHRLPDTVSLELGALVEPMSVAYHAATLGEVSAGDTAMVFGAG
PIGIGLWFALRGKGLDDVFVVEPSPTRRTAIEALGARTLDPTADDVPAFIADHTGGDGAD
AVFDAAGVTPAVATALGCVGSRKPMISVAIYEKPLETPLLNLVMNESRIQGSLCYTGADF
ESVIALMADGRYDTTGWVTRIPIDDVVDEGFEALHAGTKMKVLVDPNGAQ
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgagagcagctgtctactacggaccgaacaaactcgaggtcgacgacgtgccagaaccc
gaggctcgacccgggacggtcaagctgaaggtcggcttcaacggcatctgcggaaccgac
ctgcacgagtactacgcgggcccgatcttcgtgcccacggcgccgcatccgctgacgggc
gcgcagctgccgctgacgatgggccacgagttctccggcacgatcaccgcggtcggcgac
ggcgtcaccgggtggcaggaaggcgaccgtgtggcggtcgagccgatctacaagtgcgat
caatgcggcccgtgccgggccggcaactacaacgtctgccagcagatcggctttcacggc
ctgatgtccgacggcggcatggccgaatacaccgtggtgccgacgggcatgctgcaccgg
ctgcccgacaccgtgtcgctggagctcggcgcgctggtcgagccgatgtcggtggcctat
cacgccgccaccctcggcgaggtcagcgccggtgacacggccatggtgttcggcgccggc
cccatcgggatcggcctgtggttcgcgttgcgcggcaaagggcttgacgacgtgttcgtg
gtggagccgtcaccgacccgccgcaccgcgatcgaagcgctcggtgccaggaccctcgac
ccgacagccgacgacgtgccggccttcatcgccgaccatacgggcggcgatggcgccgac
gcggtgttcgacgccgccggcgtgacaccggcggtcgccaccgcgctgggctgcgtcggg
tcccgaaagccgatgatcagcgtcgccatctacgaaaaacccttggagacaccgcttctg
aatctcgtgatgaacgagtcgaggatccagggctcgctgtgttacaccggcgccgacttc
gagtcggtgatcgcgctgatggccgacggccgatacgacaccaccggctgggtcacccgg
atcccgatcgacgacgtggtcgacgagggcttcgaagcgttgcacgccggcacgaagatg
aaggttctcgtcgatccgaacggagcgcaatag

DBGET integrated database retrieval system