KEGG   Mycolicibacterium gilvum PYR-GCK: Mflv_0279Help
Entry
Mflv_0279         CDS       T00498                                 

Definition
(GenBank) L-aspartate aminotransferase apoenzyme
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
mgi  Mycolicibacterium gilvum PYR-GCK
Pathway
mgi00220  Arginine biosynthesis
mgi00250  Alanine, aspartate and glutamate metabolism
mgi00290  Valine, leucine and isoleucine biosynthesis
mgi01100  Metabolic pathways
mgi01110  Biosynthesis of secondary metabolites
mgi01130  Biosynthesis of antibiotics
mgi01210  2-Oxocarboxylic acid metabolism
mgi01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mgi00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Mflv_0279
   00290 Valine, leucine and isoleucine biosynthesis
    Mflv_0279
   00220 Arginine biosynthesis
    Mflv_0279
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mgi01007]
    Mflv_0279
Enzymes [BR:mgi01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     Mflv_0279
    2.6.1.66  valine---pyruvate transaminase
     Mflv_0279
Amino acid related enzymes [BR:mgi01007]
 Aminotransferase (transaminase)
  Class I
   Mflv_0279
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Beta_elim_lyase Cys_Met_Meta_PP Alliinase_C Aminotran_3
Motif
Other DBs
NCBI-ProteinID: ABP42773
UniProt: A4T0Z5
LinkDB All DBs
Position
272421..273689
Genome map
AA seq 422 aa AA seqDB search
MSTHQAHWQAGTGQHARQREFAQSSKLQDVLYEIRGPVHEHASRLEAEGHRILKLNIGNP
APFGFEAPDVIMRDIIAALPYAQGYSDSKGIVSARRAVFTRYELVEGFPRFDIDDVFLGN
GVSELIQMTLQALLDNGDQVLIPAPDYPLWTACTSLAGGTPVHYLCDETQGWNPDVADIE
SKITDRTKAIVVINPNNPTGAVYSREVLTQIADLARKHQLLLLADEIYDKILYDDAEHIS
LASVAPDLLTLTFNGLSKAYRVAGYRSGWLVITGPKEHAASFIEGISLLANMRLCPNVPA
QHAIQVALGGHQSIDDLVLPGGRLLEQRDIAWETLNEIPGVSCVKPQGALYAFPRLDPEV
YDIADDEQLVLDLLLQEKILVVQGTGFNWPTPDHLRIVTLPWARDLSAAIERLGNFLVSY
RQ
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgagtacgcaccaggcgcactggcaggcaggcactggccagcacgcgcgtcagcgcgag
ttcgcgcagtccagcaagctgcaggacgtcctgtacgagatccgtgggcccgtgcacgag
cacgcctcgcggctggaggccgagggccaccggatcctgaagctcaacatcggcaacccc
gccccgttcggcttcgaggcccccgatgtgatcatgcgcgacatcatcgccgcgctcccc
tacgcgcagggctactccgactccaagggcatcgtcagcgcccgccgcgcggtgttcacc
cgctacgagctcgtcgagggcttcccgcgcttcgacatcgacgatgtgttcctcggcaac
ggtgtctccgagctgatccagatgacgctgcaggcgctgctggacaacggcgaccaggtg
ctgatcccggcaccggactatccgctgtggaccgcgtgcacctcgctggccgggggcacc
ccggtgcactatctgtgcgacgagacgcagggctggaaccccgacgtcgccgacatcgag
tcgaagatcaccgaccgcaccaaggcgatcgtggtgatcaacccgaacaacccgaccggc
gcggtctacagccgcgaggtcctcacccagatcgcggacctggcgcgcaagcaccagctg
ctgctgctggccgacgagatctacgacaagatcctctacgacgacgccgagcacatctcg
ctggcctcggtggcgcccgacctgctgacgttgacgttcaacgggctgtccaaggcctac
cgggtggccgggtaccgctccgggtggctggtgatcaccgggcccaaggaacacgccgcc
agtttcatcgagggcatcagcctgctggccaacatgcggctgtgcccgaatgtccctgcc
cagcatgcgattcaggtggcactcggtggccatcagagcatcgacgacctggttctgccc
ggtggccgcctcctcgagcagcgtgacatcgcgtgggagacactcaacgagatccccggg
gtgtcgtgcgtcaaaccccagggtgcgctgtatgcgttcccgcgcctggaccccgaggtc
tacgacatcgccgacgacgagcaactggtcctcgacctgctcctgcaggagaagatcctg
gtggtccagggcaccggattcaactggcccacaccggatcacctgcgcatcgtgacgttg
ccgtgggcccgcgacctgtcagcggccatcgagcggctcggcaacttcctcgtcagctac
cggcagtaa

DBGET integrated database retrieval system