KEGG   Mycolicibacterium gilvum PYR-GCK: Mflv_0594
Entry
Mflv_0594         CDS       T00498                                 

Definition
(GenBank) phthalate 3,4-dioxygenase, beta subunit
  KO
K18252  phthalate 3,4-dioxygenase subunit beta [EC:1.14.12.-]
Organism
mgi  Mycolicibacterium gilvum PYR-GCK
Pathway
mgi00624  Polycyclic aromatic hydrocarbon degradation
mgi01100  Metabolic pathways
mgi01120  Microbial metabolism in diverse environments
mgi01220  Degradation of aromatic compounds
Module
mgi_M00636  Phthalate degradation, phthalate => protocatechuate
Brite
KEGG Orthology (KO) [BR:mgi00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00624 Polycyclic aromatic hydrocarbon degradation
    Mflv_0594
Enzymes [BR:mgi01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.12  With NADH or NADPH as one donor, and incorporation of two atoms of oxygen into the other donor
    1.14.12.-  
     Mflv_0594
SSDB
Motif
Pfam: Ring_hydroxyl_B SnoaL_2
Other DBs
NCBI-ProteinID: ABP43084
UniProt: A4T3D4
LinkDB
Position
complement(620497..621096)
AA seq 199 aa
MSVHDHQRIGQSAAPSVLGAHAARAQRVGDPLPFDDPRHLQAHSFLVNEAYLLDAQDYDR
WLGLLTEDIHYYMPVRITTAAGAGFDSSPGMAHFDENKYSLSRRVARFATEHAWTEDPPS
RLRHFITNVRTFLTDDADYLAVDSAELLFRSRGDVNESTLLSCGREDLLRRDGNALKLAR
RTIAVDESVLRMQNLAVFL
NT seq 600 nt   +upstreamnt  +downstreamnt
atgagcgttcacgatcaccagcgcattggtcaatccgcggctccatcggtgctcggggcg
cacgcggcgcgcgcccaacgcgtcggcgacccgttaccgttcgacgaccctcgtcacctc
caggcgcatagtttcctcgtcaacgaggcgtaccttctcgatgctcaagactacgaccgg
tggctgggtctgcttaccgaggacatccactattacatgccggtgcggatcaccaccgcc
gcgggagccggatttgatagctcaccgggaatggcgcatttcgacgagaacaaatactca
ctcagtcgccgcgttgcccgattcgccaccgagcatgcctggactgaggatccgccgtcg
cgcctgcgccacttcatcaccaacgtgcgcacattcctcaccgacgacgccgactacctc
gcggtcgacagcgctgagttgttgttccgcagccgcggcgacgtcaatgagtccacgctc
ctctcatgcggtcgtgaagatctcctacgtcgcgatggcaacgccctcaaactcgcccgg
cgcacaatcgccgtcgatgaatcagtgcttcgaatgcagaatctggcggtattcctatga

DBGET integrated database retrieval system