KEGG   Mycolicibacterium gilvum PYR-GCK: Mflv_0595
Entry
Mflv_0595         CDS       T00498                                 

Definition
(GenBank) phthalate 3,4-dioxygenase, alpha subunit
  KO
K18251  phthalate 3,4-dioxygenase subunit alpha [EC:1.14.12.-]
Organism
mgi  Mycolicibacterium gilvum PYR-GCK
Pathway
mgi00624  Polycyclic aromatic hydrocarbon degradation
mgi01100  Metabolic pathways
mgi01120  Microbial metabolism in diverse environments
mgi01220  Degradation of aromatic compounds
Module
mgi_M00636  Phthalate degradation, phthalate => protocatechuate
Brite
KEGG Orthology (KO) [BR:mgi00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00624 Polycyclic aromatic hydrocarbon degradation
    Mflv_0595
Enzymes [BR:mgi01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.12  With NADH or NADPH as one donor, and incorporation of two atoms of oxygen into the other donor
    1.14.12.-  
     Mflv_0595
SSDB
Motif
Pfam: Ring_hydroxyl_A Rieske
Other DBs
NCBI-ProteinID: ABP43085
UniProt: A4T3D5
LinkDB
Position
complement(621093..622544)
AA seq 483 aa
MQDHGEVLAAVRTGMIPAHVYNDKQIFSLEKERLFSRAWLFVAHESEIPQPGDYVVRQVL
QDSFIVARDSAGEVRVMFNMCLHRGMQVCRAEMGNASNFRCPYHGWSYRNDGRIIGLPFH
QEAYGGDAGFNKAGQTLLPAPSVASYNGLIFLSMDPDAESLEDYLGDFRFYLDFYTKQGP
NGLEVRGPQRWRVKANWKIAAENFAGDMYHTPQTHTSVVEIGLFREPKANKRKDGATYWA
GRGGGTTYKLPEGSFEDRMSYVGYPADMISRAKATWTEQQQQVVGTDGFMISAATCFPNI
SFVHNWPKVEDGEHVLPFISIRVWQPISENETEVLSWFAVDSDAPADFKADSYKAYLMCF
GSTGMFEQDDVENWVSLTNTAGGSMARRLRLNSRMGLLADDVRVVDTLSSAQFHGPGYAQ
LGYNENNQRQLLRLWADYLDMPPLRVDPATVLSDNPHGIEPMVQTNGAAAADIDSGSAES
VML
NT seq 1452 nt   +upstreamnt  +downstreamnt
atgcaggatcacggtgaggtgttggcggctgtacgcactggcatgatcccggcgcacgtg
tataacgacaagcagattttttcgctcgagaaggagcggctgttcagtcgggcgtggttg
ttcgtggcgcacgaatcggagattccgcaaccgggggactacgtggtcagacaagtgttg
caggattcgttcatcgtcgctcgtgattctgcgggcgaggtccgggtgatgttcaatatg
tgcctccatcgcggtatgcaggtttgtcgggcggagatggggaacgcgtcgaacttcaga
tgcccgtaccacgggtggtcttaccgcaatgacggccgcattatcggactgccttttcac
caagaggcctatggaggagacgcggggtttaacaaggcggggcagaccctgttgccagcg
ccgagtgtggccagctacaacgggttgatctttctgtcgatggatcctgacgcagaatcg
cttgaagactatctgggtgatttcaggttctatctcgatttctacaccaagcaaggcccc
aacggtcttgaggtgcgaggtccgcagcgttggcgggtaaaagcgaactggaagatcgca
gctgaaaatttcgccggggacatgtaccacacacctcagacgcacacgtcggtggtcgag
atcggcctgttccgagagccgaaggctaacaagcgcaaagacggcgccacgtattgggcg
ggtagaggtgggggcaccacatacaagctgcccgaggggagtttcgaggaccggatgagc
tatgtgggctacccggcggacatgattagtcgagccaaggccacctggaccgagcagcag
caacaagtcgtcggcaccgacgggttcatgatctcggccgcgacgtgttttcccaacatc
agtttcgtgcacaactggccgaaagtggaggacggggagcacgtcttgccgttcatttca
atccgggtgtggcagccaatcagcgagaacgaaaccgaggtgctgtcgtggtttgcggtg
gattctgatgccccggcagactttaaggcggactcgtataaggcttatttgatgtgcttc
ggctcgacgggaatgttcgagcaagacgatgtcgagaactgggtgtcgctgaccaacacg
gcggggggttccatggcccgccgactgcggctgaacagccggatggggctgctcgcagac
gatgtacgggtggtcgacacccttagcagcgctcaattccacgggccgggatacgctcag
ctcggttacaacgagaacaatcaacggcaattgttgaggctctgggccgactacctggac
atgccgccgctgcgcgtcgacccggctacggtgctcagcgacaatccgcatggaattgaa
ccaatggtccagaccaacggcgcggccgccgccgatattgactcggggtccgctgagtcg
gtgatgctatga

DBGET integrated database retrieval system