KEGG   Mycolicibacterium gilvum PYR-GCK: Mflv_0680
Entry
Mflv_0680         CDS       T00498                                 

Definition
(GenBank) phthalate 3,4-dioxygenase, ferredoxin reductase subunit
  KO
K18254  phthalate 3,4-dioxygenase ferredoxin reductase component [EC:1.18.1.3]
Organism
mgi  Mycolicibacterium gilvum PYR-GCK
Pathway
mgi00624  Polycyclic aromatic hydrocarbon degradation
mgi01100  Metabolic pathways
mgi01120  Microbial metabolism in diverse environments
mgi01220  Degradation of aromatic compounds
Module
mgi_M00636  Phthalate degradation, phthalate => protocatechuate
Brite
KEGG Orthology (KO) [BR:mgi00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00624 Polycyclic aromatic hydrocarbon degradation
    Mflv_0680
Enzymes [BR:mgi01000]
 1. Oxidoreductases
  1.18  Acting on iron-sulfur proteins as donors
   1.18.1  With NAD+ or NADP+ as acceptor
    1.18.1.3  ferredoxin---NAD+ reductase
     Mflv_0680
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox Reductase_C 2-Hacid_dh_C AlaDh_PNT_C XdhC_C DAO NAD_binding_8 Pyr_redox_3 3HCDH_N UDPG_MGDP_dh_N NAD_binding_7 Amino_oxidase K_oxygenase GIDA AdoHcyase_NAD FAD_binding_2
Other DBs
NCBI-ProteinID: ABP43167
UniProt: A4T3E0
LinkDB
Position
complement(700882..702123)
AA seq 413 aa
MTSRVVIVGSSVGGVRTAQALRSQGYDGGIVLVGEETALPYDKPPLSKALLAGTSDIAAA
TLLTRDAAAADAIELLLGRRAIGVDVAACQVEFADDEPLHYDHLVVATGASARPSPWGHG
SGVHVLRTLEDCLRLRADLVAGARLVVIGAGFIGAEVASTARSLGLQVTVVDPVPVPMSR
VLTEEIGGWFVDLHRDHGVHTRFGVGVENIEGERGNLKIGLTDGTVLEADTVVVGIGAVP
NDGWLMPSGLVVDDGLVCDEFCRAVTSQNIYAVGDVSRWFHRARGVTMRIEHWTNAVDQA
SCVAHNILYPDELRCYEPVEYVWSDQYDWKIQFCGQTTHLGEPLVVGDRLSDNRFTVLYP
DGEQRLGGAAVVNWPRALIECRRALQAGSDLESVRGRLEVLTNPPDTAATRSP
NT seq 1242 nt   +upstreamnt  +downstreamnt
atgacgtcacgggtcgtcatcgtcggcagttctgtcggcggggtccgcacggcccaggcg
ctgcgctcgcaaggctacgacggcggcatcgtcctggtgggcgaggaaactgcgctgccc
tacgacaagccgccgctatccaaagcgttgcttgcgggtacgagtgacatcgcggctgcg
acgttactcaccagagacgctgccgccgccgacgccatcgagcttctcctcggccgccgc
gcgatcggagtggatgtcgcagcgtgtcaggtcgagttcgccgatgatgagcccctgcat
tatgaccacctggtggtggccaccggagccagcgcgcgaccatccccgtggggccacgga
tcgggcgttcatgtgctccgcactctggaggactgtctgcggctaagagccgacctcgtt
gccggtgcccgcctcgtggtgatcggggcaggatttattggggccgaggtcgcgtcaacc
gcgcggtcactggggctgcaagtgacggttgtcgacccggtgccggtgccgatgagccgg
gtgctgaccgaagagatcggtgggtggttcgtcgatttgcaccgagaccacggagtgcac
acgcgattcggcgtcggtgtcgagaatattgagggggagcgcggcaaccttaagatcggc
ctcacggacgggaccgtcctagaagccgacacggtggtggtgggcatcggcgccgttccg
aatgacggctggctgatgccgtcgggactggtcgtcgatgacggcctggtctgcgacgag
ttctgccgcgccgtcacgtcacaaaacatctacgcagtcggcgacgtgtcgcgttggttc
catcgcgcgcgcggcgtgacgatgcgcatcgaacactggacaaacgcggtcgaccaggcc
tcttgcgtcgcgcataatattttgtatcccgatgaattgcgctgctacgagcccgtcgag
tacgtctggagcgaccagtacgactggaagatccagttttgcggccaaacaactcaccta
ggagagccactcgtcgtcggagatcgactgtccgacaatcgattcacagtcctctacccg
gatggcgagcaacgtcttggtggcgcggcggtggtgaactggcctcgagcactgatcgag
tgcaggcgtgcgctgcaggccggtagcgatctcgaaagtgtgcggggaaggctcgaagtg
ttgacgaacccacccgataccgccgcaacgcgatcgccatag

DBGET integrated database retrieval system