KEGG   Mycolicibacterium gilvum PYR-GCK: Mflv_0681
Entry
Mflv_0681         CDS       T00498                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K18253  phthalate 3,4-dioxygenase ferredoxin component
Organism
mgi  Mycolicibacterium gilvum PYR-GCK
Pathway
mgi00624  Polycyclic aromatic hydrocarbon degradation
mgi01100  Metabolic pathways
mgi01120  Microbial metabolism in diverse environments
mgi01220  Degradation of aromatic compounds
Module
mgi_M00636  Phthalate degradation, phthalate => protocatechuate
Brite
KEGG Orthology (KO) [BR:mgi00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00624 Polycyclic aromatic hydrocarbon degradation
    Mflv_0681
SSDB
Motif
Pfam: Fer4_15 Fer4_13 Fer4_19
Other DBs
NCBI-ProteinID: ABP43168
UniProt: A4T3E1
LinkDB
Position
complement(702120..702320)
AA seq 66 aa
MDGVIKAKREVCQGYANCVVAAEDYFDIDDRGLVEVRKTEVPSADRTRVEEAARSCPVAA
LEVVDE
NT seq 201 nt   +upstreamnt  +downstreamnt
atggacggagtcataaaggctaagcgcgaggtatgtcagggctacgcgaactgtgtcgta
gccgccgaggattacttcgacatcgacgatcggggactcgtggaggtccgcaagacggag
gttccttccgcggacaggacccgggtcgaggaggctgcgcgcagctgtccggtggcagcg
ttggaagtcgtagacgaatga

DBGET integrated database retrieval system