KEGG   Mycolicibacterium gilvum PYR-GCK: Mflv_1254Help
Entry
Mflv_1254         CDS       T00498                                 

Definition
(GenBank) ATP dependent DNA ligase
Organism
mgi  Mycolicibacterium gilvum PYR-GCK
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C
Motif
Other DBs
NCBI-ProteinID: ABP43736
UniProt: A4T655
LinkDB All DBs
Position
complement(1306721..1307821)
Genome map
AA seq 366 aa AA seqDB search
MAGMRLPVMPPLSPMLSKSVQQIPDGASYEPKWDGFRSIVFRDGDEIEFGSRNERPMTRY
FPELVAAARSELPPRCVVDGEIVIATAGGLDFEALQLRLHPAASRVTMLAEKTPASFIAF
DLLALGDTDLTGRPFTERRAALVDALAGAGPTFHVTPATRDIALATRWFDEFEGAGLDGV
IAKPVDGVYLPDKRTMFKIKHRRTADCVVAGYRLHKSGDDAVGSLLLGLYDSDGALASVG
VIGAFPMARRRALLAELQPLVTTFDEHPWNWAAHADPDVVRRHGGGSRWNAGKDLSFVPL
RPERVVEVRYDHMEGRRFRHMAQFNRWRPDRTPRSCTFDQLEQPVSFSLDDIGPGLTPRA
GRPYRS
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atggcggggatgcgcctacccgtgatgcccccgctctcaccgatgctctcgaagtcggtg
cagcagatcccggacggcgcctcgtatgaaccgaagtgggacggcttccggtcgatcgtg
ttccgtgacggcgacgagatcgaattcggcagccgcaacgaacgcccgatgacccgttac
ttcccggagctcgtcgcggcggcccgctccgagcttcccccgcgctgcgtcgtcgacggc
gagatcgtgatcgcaaccgccggcggactcgacttcgaagcgctgcagttgcgtctgcac
ccggccgcatcgcgggtcaccatgctggcggagaagaccccggcgtccttcattgcattc
gacctgctggcactcggcgacaccgacctgaccggccgcccgttcaccgaacggcgcgcg
gcactggtcgacgcgctcgccggtgccggaccgacgttccacgtcaccccggccacccgg
gacatcgcgctggccactcgatggttcgacgagttcgagggcgcgggcctggacggggtg
atcgccaagcctgtcgacggcgtctacctgccggacaagcggacgatgttcaagatcaag
caccggcgcaccgccgactgtgtggtcgcggggtaccggttgcacaagtccggtgacgac
gctgtcggctcgctgctgctcgggctctacgactccgacggcgcgctcgcgtcggtcggc
gtgatcggtgcgttcccgatggcgcggcgacgtgcgcttctcgccgaattgcagccgctg
gtgacgaccttcgacgagcatccgtggaactgggccgcgcacgccgacccggacgtcgtc
cgccggcacggcggcgggtcacggtggaacgccggcaaggacctgtccttcgtgccgctg
cgccccgaacgggtcgtcgaagtgcgctacgaccacatggagggcaggcggttccgccat
atggcgcagttcaaccggtggagaccggaccgcacgccgcgctcgtgcaccttcgatcag
ctcgagcagccggtgagtttcagcctcgacgacatcgggccgggcctcacgccgcgtgca
gggcgtccatataggtcgtga

DBGET integrated database retrieval system