KEGG   Mycolicibacterium gilvum PYR-GCK: Mflv_2720Help
Entry
Mflv_2720         CDS       T00498                                 

Definition
(GenBank) protein of unknown function DUF477
Organism
mgi  Mycolicibacterium gilvum PYR-GCK
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPM_phosphatase DUF4381 Phage_holin_2_4
Motif
Other DBs
NCBI-ProteinID: ABP45197
UniProt: A4T2A5
LinkDB All DBs
Position
complement(2860364..2862349)
Genome map
AA seq 661 aa AA seqDB search
MRVARLLPLLLALLTVGLLGAPAASAEPPLRLPTYLTDRAGALDAAGESEVQTAIDQLYD
DKRIRLWVVYVEDFSGQSAQTWAQTTFTRSDLGDQDVILAVATVDRAYALITPRGGAVRA
DIDEVRTQQVEPRLRAGDWAGAAVAAAQGLAGSGGGSVSWFGVIVALALIALALTILVLW
QRRRRRKRREAEFAAAQRVDPSDPEALAAVPLDALDDLSRKIVVDVDNEVRTSESELALA
VEEFGAQDTAAFTRAVEGAKTTLAQALNVRHILDDAVPETPMQRRDLLTRVIVAAAKADQ
ELEAQREAFAALRDLVINAPSRLDTLTQQMIDLTTRITPAEQTLQQLKSQFAASALVSVS
DNIDEARSRLAYADQSITTARTLVSRPAHRQGGLVDAIHSAEAALGQARTLLDAVDSAST
DINRAVTGLPAVIADIQNGINSAGAQLAQGSVAVATELSDARDAAVQAVAEAQSSGETDP
LGAFTRLTQADADLDRLLAEVAEERETAARLSRTFDQALFNAQSRVRAVSDYIDTRRGAI
GPEARTRLAEAVRQLQAARDKQDTNLNEAIAHANGAAMLAAQAQSLANSDVTAAQRHFNG
PYGGGGGGGQMGAVIGGILIGNVLSGVLRGGLGGGGFGGGFGGGGFGGGGGGGFSGGGGR
F
NT seq 1986 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgtcgcccgcttgctgcccttgctgctcgccctcctgacggtcggacttctcggc
gcgccggccgcgtcggccgaacccccgctgcggctgcccacctacctgaccgaccgcgcc
ggtgcgctcgacgccgccggcgagtccgaggtgcagaccgccatcgaccagctctacgac
gacaagcgcatccggctctgggtggtgtacgtcgaggacttctcggggcagagcgcacag
acgtgggcgcagaccaccttcacccgcagcgatctgggcgaccaggacgtcatcctggcc
gtcgcgaccgtcgaccgcgcctacgcgctgatcaccccccggggtggtgcggtgcgcgcc
gacatcgacgaggtccgcacccaacaggtcgaaccccggctgcgcgccggcgactgggcg
ggcgcggcggtcgccgcggcccagggcctcgcgggcagcggcggcggatcggtgagctgg
ttcggcgtgatcgtcgcgctggcgctgatcgcgctggcgctgacgatcctcgtgctgtgg
cagcggcgccgccgccgcaagcggcgcgaagcggagttcgccgcggcacagcgggtggac
ccgtcggatcccgaggcgctcgctgcggtccccctcgatgcgctcgacgatctgtcccgc
aagatcgtcgtcgacgtcgacaacgaagtgcgcaccagcgagagcgaactggccctcgcc
gtcgaggagttcggcgcacaggacaccgcggcgttcacccgcgcggtcgagggcgccaag
acgacactggcccaagccctcaacgtgcgccacatcctcgacgacgcggtgcccgagacc
ccgatgcaacgacgtgacctgctgacccgcgtcatcgtcgccgccgccaaggccgatcag
gaactcgaagcccagcgcgaggcgttcgcagcgctgcgcgatctggtgatcaacgccccc
agccgcctcgacaccctcacccagcagatgatcgacctgaccacccggatcaccccggca
gaacagacgctgcaacagttgaagtcccaattcgccgcgagcgcactggtttcggtgtcc
gacaacatcgacgaggcccgcagccggctggcgtacgccgaccagagcatcaccaccgcg
cgcaccctggtgtcccggcccgcgcaccggcagggcggactggtcgacgccatccattcc
gccgaagccgcactcggccaggcccgcacactgctcgacgccgtggacagcgcgtcgacc
gacatcaaccgcgcggtcaccggcctgcccgccgtcatcgccgacatccagaacggcatc
aactccgcgggcgcccagctcgcccagggcagcgtcgcggtggccaccgagctcagtgac
gccagagacgctgcggtacaggcggttgcggaggcgcagagctcgggcgagaccgacccg
ctgggggccttcacgcggctgacccaggccgacgccgacctggaccggctcctggccgag
gtcgccgaggaacgcgaaaccgcggcgcgtctgagccgcacattcgaccaggcgctgttc
aacgcgcagtcccgggtgcgtgcggtctcggactacatcgacacccgtcgcggggccatc
ggtcccgaagcgcggacccggctcgccgaggccgtccggcaactgcaggccgcgcgcgac
aagcaggacaccaacctcaacgaggccatcgcccacgccaacggcgccgcgatgctcgcc
gcccaggcacagtcactggccaactcggatgtcactgccgcccaacggcatttcaacgga
ccgtacggcggtggcggcggaggcgggcagatgggcgcggtgatcggcggcatcctcatc
ggcaacgtgctctcgggcgtgctgcgcggaggcctcggcggtggcgggttcggcggcggc
ttcggcggcggaggcttcggcggcggtgggggcggaggcttcagcggcggcggcggccgc
ttctaa

DBGET integrated database retrieval system