KEGG   Mycolicibacterium gilvum PYR-GCK: Mflv_3394Help
Entry
Mflv_3394         CDS       T00498                                 

Definition
(GenBank) AMP-dependent synthetase and ligase
Organism
mgi  Mycolicibacterium gilvum PYR-GCK
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C_2
Motif
Other DBs
NCBI-ProteinID: ABP45870
UniProt: A4TA95
LinkDB All DBs
Position
complement(3602276..3604009)
Genome map
AA seq 577 aa AA seqDB search
MTALTEASIPAVLADRAEKQPDDIAYTFVDYEADPAGVTDSLTWSEVHERVQIVAGKLAT
IGSPGDRAVILAPQSLEYIIGFLGAVAAGFIAVPLSMPQTRHHDERVTGAMADSTPVVVL
TTSAVVEDVRRYGQADPKQRPPKFLEIDTLDFDSPPKPAPAASLPKTAYLQYTSGSTRSP
AGVVVTHKNVVVNLEQLLTDYYEAYPDGPPADTTIVSWLPFYHDMGLIVGVFIPMMLGRP
AVLMSPVAFMMKPSRWMQLLGSNPSAFTAAPNFAFELAVKRTSDEDMAGKDLSTVVVMIN
GAERVHGSTVRRFNERFAAFGLPDTAMRPSYGLAEATVYVAASAGGRPPTSARFDTEKLA
AGHAEASDGDDGTELISCGAPRSTTARVVDPDTLVENPAGKIGEVWLHGEHVAAGYWHNP
KLSELFAAQLSEPSAGTPKGPWLRTGDLGVMFDDELYIIGRIKDLLIVDGRNHYPDDIEA
TVAEFTGGRVAAVSVPDEASERLVVIAELKKQLDQSVLDSVRQQVTAAVSQTHSVRVSDF
VLVGPGSLPLTTSGKVRRASSVQLYLDDKFSRLDATT
NT seq 1734 nt NT seq  +upstreamnt  +downstreamnt
gtgacagcgctgaccgaagcctccatccccgcggtactggccgatcgcgcggagaagcag
cccgacgacatcgcgtacacgttcgtcgactacgaggccgacccggccggcgtcaccgac
agcctgacgtggtcagaggtgcacgagcgcgtgcagatcgtcgccgggaaactcgcgacg
atcggctcgccgggcgaccgcgcggtgatcctggccccgcagagcctggagtacatcatc
gggttcctcggcgcggtggccgccggcttcatcgccgtcccgctgtccatgccgcagacc
cgccaccacgacgagcgcgtcaccggcgcgatggcggactcgacaccggtggtcgtgctc
acgacctccgcggtcgtcgaggacgtccgcaggtacggccaggccgacccgaagcagcgg
ccgccgaaattcctcgagatcgacaccctcgacttcgattcgccgccgaagccggcgccc
gcggcgtcactgcccaagaccgcctacctgcagtacacctcaggttccacgcgcagcccc
gccggcgtggtcgtgacccacaagaacgtggtcgtcaatctcgagcagctgctgaccgac
tactacgaggcctatcccgacggcccgcccgcggacaccacgatcgtgtcgtggctgccc
ttctaccacgacatgggcctcatcgtcggggtgttcatcccgatgatgctgggccggccc
gcggtgctgatgagcccggtcgcgttcatgatgaagccgtcgcgctggatgcagcttctc
ggctcgaatccgagcgcgttcaccgcggccccgaacttcgcgttcgaactcgccgtcaag
cgcacctccgacgaggacatggccggcaaggacctcagcacggtcgtcgtgatgatcaac
ggcgccgagcgggtgcacggctcgacggtgcgccggttcaatgagcggttcgccgcgttc
ggccttccggacaccgcgatgcggccgtcctacggcctggccgaggcgacggtctacgtc
gcggcgtcggcgggcgggcggccccccacgtccgcgcgcttcgataccgagaagctcgcc
gccgggcacgcggaagcatccgacggtgacgacggcaccgagttgatcagctgcggcgca
ccgcgctcgacgaccgcgcgggtggtcgatcccgacacgctcgtcgagaatcccgcgggc
aagatcggcgaggtgtggctgcacggcgagcacgtcgccgccggctactggcacaacccg
aagctgtcggaactgttcgccgcgcagttgagcgagccgagcgccgggacgccgaagggt
ccgtggttgcgcaccggcgacctcggtgtgatgttcgacgacgagctctacatcatcggt
cgcatcaaggatctgctgatcgtcgacggccgcaaccactacccggacgacatcgaggcg
acggttgccgagttcaccggcggccgcgtcgcggcggtctctgtccccgatgaggccagt
gagcgtctggtcgtgatcgccgagctcaagaagcagctcgatcaatcggtgctggactcg
gttcgccagcaggtcaccgcggcggtgtcgcagacccatagcgtccgggtgtcggacttc
gtgctggtcggacccggctcgctgccgctgaccaccagcggcaaggtgcgccgggcctcc
agcgtgcagctctacctcgacgacaagttcagccgtctggacgccactacatga

DBGET integrated database retrieval system