KEGG   Mycolicibacterium gilvum PYR-GCK: Mflv_3945Help
Entry
Mflv_3945         CDS       T00498                                 

Definition
(GenBank) ribonuclease BN
  KO
K07058  membrane protein
Organism
mgi  Mycolicibacterium gilvum PYR-GCK
Brite
KEGG Orthology (KO) [BR:mgi00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    Mflv_3945
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Virul_fac_BrkB
Motif
Other DBs
NCBI-ProteinID: ABP46416
UniProt: A4TCP9
LinkDB All DBs
Position
4203197..4204168
Genome map
AA seq 323 aa AA seqDB search
MDDQSERPPERTFSKATPSRHHIRHIVARTLGKSWDDSIFAESAQAAFWCALSLPPLLLG
MLGSLAYVAPLFGPDTLLTIENQLISLAGKFFSPNVVGEIIEPTVRDIVNGARGEVVSLG
FVISLWAGSSAISAFVDSITEAHGQTALRHPVRQRFYALGLYVVMLIGAIVTAPFLALGP
RKVAEFIPDSWDDALRFAYFPVLFVALAVAVNVLYRVSLPKPLPTHRLLTGSLLAAGVFL
VATWGLRVYLTWITSTGYTYGALATPIAFLLFAFFLGFAIMIGAELNAAIEEEWPAPDTH
AKRLHWWLKAKAESRNGGGRSTS
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atggatgaccagtcagagcggccaccggaacggactttctcgaaagccacaccgtcacgc
caccacatccggcacatcgtcgcccgcacgttgggcaagagctgggacgattccattttc
gccgagtcggctcaagctgccttctggtgcgcgctgtcgttgcctccgctgctgttggga
atgctcggcagcctcgcctacgtggcaccgttgttcggtcccgacacgctgctgacgatc
gagaaccagctcatcagcctggcgggaaagttcttctcccccaacgtcgttggcgagatc
atcgagccgacggtgcgcgacatcgtcaacggtgcgcgcggcgaggtcgtctcactgggt
ttcgtgatctcgctgtgggcgggctcgtcggccatttcggcgttcgtcgactcgatcacc
gaggctcacggccagacggcgctgcgacatccggtccggcaacggttctacgcgctcggg
ttgtacgtggtgatgctgatcggcgccatcgtgacggcgccgttcctcgcgctcggcccc
cgcaaggtcgccgagttcatcccggacagctgggacgacgctctgcgattcgcgtacttc
ccggtgctgttcgtggccctcgccgtcgccgtgaacgtcctctaccgggtgtcgttgccc
aaaccgcttcccacacaccggctgctgacagggtcattgctcgcggccggggtgttcctc
gtggcgacctggggtctgcgggtctacctgacctggatcaccagcaccggctacacctac
ggcgcgctggcgaccccgatcgcgttcctgctgttcgcgttcttccttggcttcgcgatc
atgatcggtgccgagctcaacgcggcgatcgaagaagagtggccggcccccgacacccat
gccaagcgtctgcactggtggctcaaggccaaggccgagtcccgcaacggcggcggcagg
tctacttcttga

DBGET integrated database retrieval system