KEGG   Mycolicibacterium gilvum PYR-GCK: Mflv_4821Help
Entry
Mflv_4821         CDS       T00498                                 

Definition
(GenBank) FAD dependent oxidoreductase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
mgi  Mycolicibacterium gilvum PYR-GCK
Pathway
mgi00564  Glycerophospholipid metabolism
mgi01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mgi00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Mflv_4821
Enzymes [BR:mgi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     Mflv_4821
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_oxidored FAD_binding_2 FAD_binding_3 Pyr_redox_2 GIDA NAD_binding_8 3HCDH_N HI0933_like AlaDh_PNT_C Thi4 Pyr_redox DUF3659
Motif
Other DBs
NCBI-ProteinID: ABP47289
UniProt: A4TEY1
LinkDB All DBs
Position
complement(5131394..5133139)
Genome map
AA seq 581 aa AA seqDB search
MSDPIPAPGNGETFLGPDERARAWQRLGSEQFDVIVIGGGIVGAGAALDAATRGLKVALV
EARDFASGTSSRSSKMFHGGLRYLEQLEFGLVREALHERELSLTTLAPHLVKPLPFLFPL
TNRVWERPYIAAGIFLYDQLGGAKSVPPQKHLTRAGALRLSPGLKRSSLIGGIRYYDTVV
DDARHTMTVARTAAHYGAVVRTSTQVVALLREGDRVTGVQVRDSEDGRVTDVRGHVVVNA
TGVWTDEIQALSKQRGRFRVRASKGVHIVVPRDRIVSEVAIILRTEKSVLFVIPWGTHWI
IGTTDTDWNLDLAHPAATKADIDYILGHVNKVLATPLTHDDIDGVYAGLRPLLAGESEET
SKLSREHAVAVPSPGLVAIAGGKYTTYRVMAEDAIDAAAEFIPTRVAPSITEKVPLMGAD
GYFALINQTQSVGTYYDLHPYRVRHLLDRYGSLIGEVLKLAEDNPDLLNPITEAPVYLKV
EAAYAAAAEGALHLEDILARRMRISIEYPHRGVDCAREVAEVVAPILGWSPEDVDREVST
YLARVEAEVQSQTQPDDASADALRAAAPEARAEILEPVPLN
NT seq 1746 nt NT seq  +upstreamnt  +downstreamnt
gtgagtgacccgatccccgcgccaggcaacggggagacgttcctgggacccgacgagcgc
gcccgtgcatggcagcggctgggcagcgagcagttcgacgtgatcgtcatcggcggcggc
atcgtcggtgcgggcgcggcgctggatgccgccacgcgcggattgaaggtcgcgctggtc
gaggcccgtgactttgcgtcgggcacctccagtcgcagcagcaagatgttccacggcggg
ctgcgctacctcgagcagttggagttcggactggtccgcgaggccctgcacgagcgcgag
ctgtcgttgacgacgctcgccccacatctggtcaaacccctgccgtttctgttcccgctg
accaaccgggtgtgggagcgtccctacatcgccgcggggatcttcctctacgaccagctc
ggcggtgcgaaatcggttccgccgcagaagcatctgacccgtgccggcgcgctgcgcctg
tcgcccgggctcaagcggagctcgctgatcggcggaatccgctactacgacaccgtcgtc
gacgacgcccgccacacgatgaccgtcgcccgcacagccgcgcattacggtgcggtggtc
cggacctccacgcaggtcgtcgcgctgctgcgagaaggtgaccgggtcaccggcgtgcag
gtgcgcgactcggaggacgggcgggtcaccgatgtccggggtcacgtcgtcgtcaacgcc
accggggtgtggaccgacgagatccaggcactgtccaagcagcgcgggcgttttcgcgtg
cgcgcctccaagggcgtgcacatcgtggtgccccgtgaccgcatcgtcagcgaggtcgcg
atcatcctgcgcaccgagaagtcggtgctgttcgtcatcccgtggggcacgcactggatc
atcggaaccaccgacaccgactggaatctcgacctcgcccaccctgcggccacgaaggcc
gacatcgactacatcctcggccacgtcaacaaggtgctcgccacgccgttgacccatgac
gacatcgacggtgtctacgcggggctgcgtccgctgctggccggggagagcgaggagact
tccaagctctcgcgcgagcatgcggtggcggtgccgtccccgggtctggtcgccattgcg
ggcggtaagtacacgacctaccgggtgatggccgaagacgcgatcgacgcggccgcggag
ttcatcccgacccgcgtcgcaccgtcgatcaccgagaaggtaccgctgatgggcgccgac
gggtacttcgcactgatcaatcaaacccaaagtgtcggaacatattacgacctccatccg
taccgcgtgcggcatctgctggaccgctacgggtcgctgatcggcgaggtcctcaagctc
gccgaggacaacccggatctgttgaacccgatcaccgaagcgccggtgtacctgaaagtg
gaagcggcctacgccgcggcagccgaaggcgcgctgcacctcgaggacatcctcgcgcgc
cgcatgcggatctcgatcgaatacccgcaccgcggcgtcgactgtgcccgcgaggtcgcc
gaagtcgttgcgcccattctcggttggtcccccgaggacgtcgatcgggaggtgtcgacg
tatctggctcgcgtggaagccgaggtgcagtcgcagacccagcccgacgacgcgtccgcc
gacgcactgcgcgcggccgcacccgaggcgcgcgccgagatccttgagccggtgccgctg
aattga

DBGET integrated database retrieval system