KEGG   Mycobacterium gilvum PYR-GCK: Mflv_4951Help
Entry
Mflv_4951         CDS       T00498                                 

Definition
(GenBank) Alcohol dehydrogenase GroES domain protein
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
mgi  Mycobacterium gilvum PYR-GCK
Pathway
mgi00010  Glycolysis / Gluconeogenesis
mgi00071  Fatty acid degradation
mgi00350  Tyrosine metabolism
mgi00625  Chloroalkane and chloroalkene degradation
mgi00626  Naphthalene degradation
mgi01100  Metabolic pathways
mgi01110  Biosynthesis of secondary metabolites
mgi01120  Microbial metabolism in diverse environments
mgi01130  Biosynthesis of antibiotics
mgi01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:mgi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mflv_4951
  Lipid metabolism
   00071 Fatty acid degradation
    Mflv_4951
  Amino acid metabolism
   00350 Tyrosine metabolism
    Mflv_4951
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Mflv_4951
   00626 Naphthalene degradation
    Mflv_4951
Enzymes [BR:mgi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Mflv_4951
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N ADH_zinc_N_2 AlaDh_PNT_C 2-Hacid_dh_C HutP ELFV_dehydrog TrkA_N
Motif
Other DBs
NCBI-ProteinID: ABP47417
UniProt: A4TEL4
LinkDB All DBs
Position
complement(5270830..5271843)
Genome map
AA seq 337 aa AA seqDB search
MQAAVVTAFGEPLVVEERDLPAPGPGEALVKLVTSGVCHTDLHAAHGDWPVKPSPPFIPG
HEGYGTVVAVGDGVDDLSVGDMVGNAWLWSSCGRCEYCRTGWETLCEQQRNGGYSVDGSF
GTYMLVDAAYAARIPDGVDPVEVAPILCAGVTVYKGLKVTDTRPGQWVAISGIGGLGHVA
VQYARAMGLRVVAIDVDDSKLDLATGLGAEVVVNARTADVVAEVHRATGGVHGVLVTAVH
RDAFGQAIGLARRGGTIVFVGLPPGDFPAPIFDIVLKGLTIRGSIVGTRQDMVEAIDFFA
RGLVHPTVHTTRLDDINDVFDRMERGQIDGRVVIDYR
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgcaggccgctgtcgtcacggccttcggtgaaccgctggtggtcgaggaacgggatctg
cccgcaccgggccccggcgaggctctggtgaagctggtgacctcgggtgtctgccacacc
gatctccatgccgcgcacggggattggccagtgaagccgtccccgccgttcatccccggc
catgagggctacggcaccgtcgtggctgtcggggacggggtcgacgacctgtcggtcggg
gacatggtcggcaacgcgtggctgtggtcgtcgtgtggcaggtgcgagtactgccggacc
ggctgggagacgctgtgcgaacagcagcgcaacggcggctacagcgtcgacgggagcttc
ggcacgtacatgctggttgacgccgcgtacgccgcgcgcatccccgacggggtggacccg
gtcgaggtcgccccgatcctgtgcgccggtgtcaccgtctacaagggtctgaaggtgacc
gacacccgaccgggtcagtgggtggcgatctccggcatcggcgggctcgggcatgtggcg
gtgcagtacgcccgtgcgatgggcctgcgggtggtcgcgatcgacgtcgacgactccaag
ctcgacctggcgaccgggctcggcgcggaggtggtggtcaacgcccgcaccgcggatgtg
gtggccgaggtgcaccgcgccaccggcggggtgcacggggtgctggtgaccgccgtgcac
cgggacgcgttcggtcaggcgatcgggctggcgcgccgcggcggcaccatcgtcttcgtg
gggctgccgcccggtgacttcccggccccgatcttcgacatcgtgctcaagggtctgacg
atccgcggttccatcgtcggcacccggcaggacatggtggaggcgatcgacttcttcgcc
cgcggactcgtgcacccgaccgtgcacaccacgcgtctggacgacatcaacgacgtgttc
gaccggatggaacgcggccagatcgacggcagggtggtcatcgactaccggtag

DBGET integrated database retrieval system