KEGG   Malassezia globosa: MGL_1289Help
Entry
MGL_1289          CDS       T01043                                 

Definition
(RefSeq) hypothetical protein
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
mgl  Malassezia globosa
Pathway
mgl00010  Glycolysis / Gluconeogenesis
mgl00051  Fructose and mannose metabolism
mgl00052  Galactose metabolism
mgl00500  Starch and sucrose metabolism
mgl00520  Amino sugar and nucleotide sugar metabolism
mgl01100  Metabolic pathways
mgl01110  Biosynthesis of secondary metabolites
mgl01130  Biosynthesis of antibiotics
mgl01200  Carbon metabolism
Module
mgl_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
mgl_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mgl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MGL_1289
   00051 Fructose and mannose metabolism
    MGL_1289
   00052 Galactose metabolism
    MGL_1289
   00500 Starch and sucrose metabolism
    MGL_1289
   00520 Amino sugar and nucleotide sugar metabolism
    MGL_1289
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    MGL_1289
Enzymes [BR:mgl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     MGL_1289
Membrane trafficking [BR:mgl04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    MGL_1289
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 5856326
NCBI-ProteinID: XP_001732021
UniProt: A8PX13
LinkDB All DBs
AA seq 471 aa AA seqDB search
MCFETPGAKENVLHEKEKHFEKLLSVSDETLQEINRNFVKVLSRGLEQEDQVVPMFPTFV
FNWPTGKETGDFLSLDMGGTNIRTCLVRLKGDRTFELTQSKFRIQETYKHVDGQILFDYF
AECIRDFIEQQYGSCDNISEDLSLGFTFSYPTVQKKIDHGVLTHWTKGFGNPNTEGHDCA
DLLRQSLKRARVPVKLSSIINDTTGTLIASNYVEPDTQIACIFGTGCNAAYMEDVSEIPK
LAHLNLPPNEKMAINCEYGAFDSFDHKYLASVRTKYDEEIDLTSNKPHQQAFEKMIAGLY
LGEIFRLIVCELIYEGVLFLGQETYKIEKPFSFDTAFLSLLETDPTDELLTVMGLFKYFF
GLETELDERQFFRRLAQLIGTRSARLSACGIAAIVSKKNLLEKGCTVGIDGSLFSKYPHF
SDRLHEALEGILGPKAKSIKTRQAEDGSGAGSAVIAAMTTARKKEGHLVHV
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgtgcttcgagacaccgggtgcaaaggagaacgtattacatgagaaggaaaagcacttt
gagaaacttctctccgtctcagatgagacgctccaagaaatcaatcgaaattttgtcaaa
gttttgtctcgtggcttggagcaagaggatcaagttgtccctatgttcccgaccttcgtg
ttcaattggcccacaggtaaagagacgggtgactttctctccttggatatgggaggaaca
aatattcgaacctgtttggtcagactaaagggagaccggacttttgagctcacgcagtcc
aagttccgtatccaagagacttacaaacacgtggatggccagatactattcgattacttt
gccgagtgtattcgtgacttcattgagcaacaatatggatcttgtgataacattagcgag
gatctttcattgggctttacattcagctacccaaccgtgcaaaaaaaaatcgaccatggt
gtcctcacgcattggactaagggctttggcaaccctaacacagaagggcatgactgcgcc
gatctactgcggcaaagtctgaaaagagctcgcgtccccgtaaagcttagctctatcatc
aatgacacgacagggactttgattgcttcgaactacgtggaacctgatactcaaattgcg
tgcatttttggcactggttgtaatgcggcttacatggaagatgtttcagaaatcccgaag
cttgcacacttaaacctgcctcccaatgaaaaaatggctatcaactgcgagtatggcgca
tttgactccttcgaccacaagtacttggcgtctgtgcgcacaaaatacgacgaggaaatt
gacctcacttccaacaagcctcaccagcaagccttcgagaagatgatcgccggtctgtat
ctcggagagattttccgcttgatcgtttgcgagcttatatatgaaggagtgcttttcctt
gggcaggaaacatacaagattgagaagccgttttcatttgatacagcattcctttcactt
ctcgaaactgaccctacggatgagttgctcacagtcatgggtttgtttaagtactttttc
ggtcttgaaacagaactggatgagcgtcaatttttccgacgccttgcgcagctcatcggc
acacggtctgcgcgcttgagtgcttgcggtattgccgctattgtgtcgaagaaaaacttg
ctcgagaaaggttgcacggttggtattgatggcagtttgttctccaagtaccctcacttc
tctgatcgtctgcatgaagcacttgagggcattcttggtcctaaggccaagtcaatcaag
acgcgtcaagccgaagacgggtcaggtgctggttctgccgtcattgcagccatgaccacg
gcgcgtaagaaagaaggtcaccttgtgcatgtctag

DBGET integrated database retrieval system