KEGG   Malassezia globosa: MGL_3463Help
Entry
MGL_3463          CDS       T01043                                 

Definition
(RefSeq) hypothetical protein
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
mgl  Malassezia globosa
Pathway
mgl00020  Citrate cycle (TCA cycle)
mgl00190  Oxidative phosphorylation
mgl01100  Metabolic pathways
mgl01110  Biosynthesis of secondary metabolites
mgl01130  Biosynthesis of antibiotics
mgl01200  Carbon metabolism
Module
mgl_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mgl_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
mgl_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:mgl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MGL_3463
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    MGL_3463
Enzymes [BR:mgl01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     MGL_3463
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C GIDA Thi4 Pyr_redox_2 FAD_binding_3 Lycopene_cycl DAO HI0933_like
Motif
Other DBs
NCBI-GeneID: 5853735
NCBI-ProteinID: XP_001729428
UniProt: A8Q9D8
LinkDB All DBs
AA seq 657 aa AA seqDB search
MIAGSALMRTVSRTSVPRAHSLRLSVRANAFHASAQASRVVGTQPLRAKAMSNTPGMPDL
TKGYPVIEHEYDAIVVGAGGAGLRAAFGLAEGGLNTACITKLFPTRSHTVAAQGGINAAL
GNMTEDDWRWHMYDTVKGSDWLGDQDAIHYMCREAPNTVLELEHYGLPFSRTKEGKIYQR
AFGGQSLHYGKGGQAYRCAAAADRTGHAMLHTLYGQSLRHNTTYFIEYFAQDLIMEDGEC
VGVMALNLEDGTIHRFRAHRTVLATGGYGKAYFSATSAHTCTGDGLAMVSRAGLPLQDLE
FVQFHPTGIYGAGCLITEGSRGEGGYLLNSEGERFMERYAPTAKDLASRDVVSRSMTMEI
RDGRGVGPMKDHIYLQLSHLPASVLHERLPGISETASIFAGVDVTKEPIPVLPTVHYTMG
GIPTRYTGEVLTQDENGNDKVVPGLYAAGETACVSVHGANRLGANSLLDIVVFGRACASH
IRENLEPGKPHKELKGDNGQQAINDLDAIRTADGPRTTADIRLEMQRVMQSDAAVFRTQK
TLEEGVEKIDKVVSEFPKVAVKDRGMIWNTDLTETLELRNLLSSAAQTMHSAEARKESRG
AHAREDFTERDDENWMRHTLSWFDEESGKVSLKYRNVISDTLDESECKSVPPFKRTY
NT seq 1974 nt NT seq  +upstreamnt  +downstreamnt
atgattgctggtagtgcgttgatgcgcactgtgtcgcgcacgtccgtgcctcgcgctcat
tcgttgcgtctatctgttcgtgcgaatgcattccatgcatcagcacaggcttcgcgtgtc
gttggcacacaaccccttcgtgcgaaagccatgtcgaacacaccaggtatgccggacttg
acaaaaggctaccctgtgatcgagcacgagtacgatgctattgtcgtcggtgctggtggt
gccggtttgcgcgctgccttcggtcttgccgagggtggtctgaacacggcgtgtattaca
aagctgtttcccacgcgctctcacacagtcgctgctcagggcggtatcaatgctgcgctg
ggtaacatgacagaggatgactggcgctggcacatgtatgacacagtcaagggttctgac
tggcttggtgaccaggacgccattcattacatgtgccgtgaagcgccgaacacggtgcta
gagcttgaacactacggtctaccattctcgcgtactaaggagggcaagatttaccagcgt
gccttcggtggtcaatccctccactacggcaagggtggccaggcctaccgttgcgctgcc
gctgcagaccgcacgggacatgctatgcttcacactctgtacggccagtcgctgcgtcac
aataccacatactttattgagtactttgcccaggatctgatcatggaagatggcgagtgt
gtgggtgtgatggcgctcaacctggaagatggcaccatccaccgattccgtgctcaccgc
acggtccttgccacgggtggatatggaaaggcatacttcagtgctacaagtgcgcacact
tgcacaggtgatggtcttgctatggtgtcgcgtgccggtctgccccttcaggacctcgaa
ttcgtgcagttccacccaacaggcatttatggtgcgggctgtctcatcacggaaggctcg
cgcggtgaaggtggctatcttctcaactcagaaggggagcggttcatggagcgatacgcc
ccaacggcgaaggacctggcctcgcgtgacgtcgtgtcgcgttccatgacaatggagatc
cgcgatggccgtggtgtcggtcctatgaaggaccacatttacttgcagctctcccacttg
cctgcttcggtgctgcatgagcgcctgccaggtatttctgagactgccagtatctttgcg
ggtgtcgacgtgacaaaagagcctatcccagtgttgccgaccgtacactacacaatgggt
ggtatcccgacgcgttacacgggtgaggtactcacacaggacgagaacggcaacgacaag
gttgttcctggtctgtacgctgctggtgagacagcgtgtgtatcggtgcacggcgccaat
cgcctgggtgcgaactctttgctggacattgtggtgtttggtcgtgcttgtgccagtcac
atccgcgagaacctcgagcctggtaagccgcacaaggaacttaagggagacaatggtcaa
caggccattaatgatctggatgcgatccgcacggccgacggcccccgcacgacagccgac
atccgtctggagatgcagcgcgtcatgcagtcagatgccgccgtgttccgtacgcaaaag
acgcttgaggagggtgtggagaagattgacaaggtggtgagcgagttcccgaaggtcgct
gtgaaggaccgtggcatgatctggaacacggatctgaccgagacgctggagcttcgcaac
ctgctgagcagtgcagcccagacaatgcactcggcagaggctcgtaaggagtcgcgaggt
gcgcatgcacgcgaagacttcactgagcgtgatgacgagaactggatgaggcacacgcta
tcatggttcgatgaggagtcgggcaaggtgagcctcaagtaccgtaatgtgatcagcgac
acacttgatgaaagcgagtgcaagagtgtgccgccgttcaagcgtacgtactaa

DBGET integrated database retrieval system