KEGG   Malassezia globosa: MGL_3610Help
Entry
MGL_3610          CDS       T01043                                 

Definition
(RefSeq) hypothetical protein
  KO
K11426  [histone H3]-lysine4/36 N-trimethyltransferase SMYD [EC:2.1.1.354 2.1.1.357]
Organism
mgl  Malassezia globosa
Pathway
mgl00310  Lysine degradation
mgl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mgl00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    MGL_3610
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mgl03036]
    MGL_3610
Enzymes [BR:mgl01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.354  [histone H3]-lysine4 N-trimethyltransferase
     MGL_3610
    2.1.1.357  [histone H3]-lysine36 N-dimethyltransferase
     MGL_3610
Chromosome and associated proteins [BR:mgl03036]
 Eukaryotic type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     MGL_3610
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET Peripla_BP_1
Motif
Other DBs
NCBI-GeneID: 5853449
NCBI-ProteinID: XP_001729143
UniProt: A8QA51
LinkDB All DBs
AA seq 390 aa AA seqDB search
MRHASDWWRPIAAMQSNRQKMSASVRDEAATLAYRLARYIGSEQDLRALGLPSADALMEL
VCQHETNAFTLADAHLNPLGVCIEPTFALINHSCDPNAVIVFPDRVRGMPSKMHLVAIRA
ISAGEEVRISYVDVASCQAERQATLLERYCFACECRLCKRMGWRDPRMALWCPQPKCTGW
VVFQNAASSWTACTQCEQVPNYVDTRALDAAPALVRHVQQAMYAQDESATLPSSSIICDT
LRQLCTQALPSHYSVWPLLYAAHTLAIEAHAWHDAVQWTMLLCVGMQAGERTSQNEISTA
LYPAGHPQRAVLLATLARLLCQDAVLGLDSLVRSVTRALAWPPIHLDAPDARGRLAQAAL
VQALQEAMVAFGKETGGGAIGAEIRESLGE
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgagacatgcgtctgactggtggcgccctatagcagcgatgcaatcaaatcggcaaaag
atgagtgccagtgtacgtgatgaagcagccacattggcatatcgcctcgctcgttacatt
ggctcggaacaagaccttcgtgctcttgggcttcccagtgccgatgctttgatggagctc
gtatgtcagcacgaaacaaacgccttcacgttggcggatgcacatctgaatcctcttggc
gtatgcattgaaccaacattcgcacttataaaccactcttgtgatccaaatgcagttatt
gtttttcctgaccgcgtgcgtggcatgccaagcaagatgcatttagtggcgatccgagca
attagtgccggtgaagaggtgcgaatatcgtacgtggatgtggcttcgtgccaagctgaa
cggcaagcaacattgctagagcgatactgctttgcatgtgaatgccgactctgcaaacgt
atgggctggcgcgacccccgcatggcactgtggtgtccccagccgaaatgcactggttgg
gtagtgtttcaaaacgcagcatcctcttggacagcctgtacacaatgcgaacaagtgccg
aactacgtggatacgcgtgccctagatgcagcacctgcacttgtgcgacatgtgcaacaa
gcgatgtacgcgcaagacgaaagcgcgacccttccatcgagctccatcatttgcgataca
ctacgtcagctatgtacgcaggcacttccatcgcattatagtgtgtggccattgttgtac
gcagcacatacactggcaatcgaggcacacgcttggcatgacgctgtgcaatggacgatg
ctcttgtgcgtaggaatgcaggcgggagaaagaacgtcgcaaaatgagattagcacagct
ctatacccggctgggcatccacagcgagccgtgttgctagctacgttagctcgccttctg
tgtcaagacgcggtgttggggcttgattcgcttgttcgttccgtcacacgcgcacttgca
tggccaccgatccatctcgatgcgcctgacgcacgtggcaggttggcccaggcagcgttg
gtccaggctctacaagaggccatggtggcgtttggaaaagaaacaggcgggggtgcaatc
ggtgcagagatccgcgagagccttggagaataa

DBGET integrated database retrieval system