KEGG   Magnetococcus marinus: Mmc1_0958Help
Entry
Mmc1_0958         CDS       T00427                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K00797  spermidine synthase [EC:2.5.1.16]
Organism
mgm  Magnetococcus marinus
Pathway
mgm00270  Cysteine and methionine metabolism
mgm00330  Arginine and proline metabolism
mgm00410  beta-Alanine metabolism
mgm00480  Glutathione metabolism
mgm01100  Metabolic pathways
Module
mgm_M00133  Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Brite
KEGG Orthology (KO) [BR:mgm00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Mmc1_0958
   00330 Arginine and proline metabolism
    Mmc1_0958
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Mmc1_0958
   00480 Glutathione metabolism
    Mmc1_0958
Enzymes [BR:mgm01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.16  spermidine synthase
     Mmc1_0958
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Spermine_synth PCMT Methyltransf_25 Methyltransf_12
Motif
Other DBs
NCBI-ProteinID: ABK43476
UniProt: A0L683
LinkDB All DBs
Position
complement(1175548..1176360)
Genome map
AA seq 270 aa AA seqDB search
MDNPANIIYQRRHQGTTVEVVEKEGLRCLTFGSHLRQSCMLLSDPAFLFLPYSRHMMAAL
LFLPQLPQRILLIGLGGGSLVKFFLHHLPQCHVEVVEYDPHIVTIAQDFFHLPKNHPRLT
IHLGDGAQFFSLGGAQQAPYDLILLDAFDANGLVTSIYRPPFLKLCQDHLAAPGIVAANV
SRGNKGHFQEALGNWKNAYPDYGWMVPVARSQNAILIATPHHTAMPQHMPQADQAHALGQ
HLPLNFIPLMERIDPIANTFWQRIAQAVSS
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atggataaccccgccaacattatctatcagcgccgtcaccagggcaccaccgtcgaggtg
gtggaaaaagagggcttgcgctgcctaacctttggttcccacctgcgccagagctgcatg
ttactctcggaccctgcctttctctttttgccctactcgcgccatatgatggcggccctg
ctctttttaccccaacttccccagcgtattctgctgattggtttggggggtggctcactg
gttaaattttttctgcatcatctgccccaatgtcatgtggaggtggtggagtatgatccc
catattgtcaccattgcccaggattttttccatctccctaaaaatcatccccggctcacc
atacatcttggggatggtgcccaatttttctcccttggtggcgcccaacaggccccctat
gacttgattttattggatgcctttgatgccaacgggctggtgaccagcatttatcgcccc
ccctttctcaagctctgtcaagaccatttggccgcaccaggtatcgtcgccgccaatgtc
tcccgtggtaataagggccattttcaagaggcgctgggcaactggaaaaacgcctatcca
gactatggttggatggtccctgtcgcccgctcacaaaacgctattctcatcgccaccccg
caccatacggcgatgccgcaacatatgccccaggccgatcaggcccatgccctgggccaa
catctgccccttaattttatccccctcatggagcgcattgaccccattgccaacactttt
tggcagcgtattgcccaagcggtatcctcctaa

DBGET integrated database retrieval system