KEGG   Mycolicibacterium goodii: AFA91_01980Help
Entry
AFA91_01980       CDS       T04008                                 

Definition
(GenBank) aminotransferase
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
mgo  Mycolicibacterium goodii
Pathway
mgo00220  Arginine biosynthesis
mgo00250  Alanine, aspartate and glutamate metabolism
mgo00290  Valine, leucine and isoleucine biosynthesis
mgo01100  Metabolic pathways
mgo01110  Biosynthesis of secondary metabolites
mgo01130  Biosynthesis of antibiotics
mgo01210  2-Oxocarboxylic acid metabolism
mgo01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mgo00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AFA91_01980
   00290 Valine, leucine and isoleucine biosynthesis
    AFA91_01980
   00220 Arginine biosynthesis
    AFA91_01980
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mgo01007]
    AFA91_01980
Enzymes [BR:mgo01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     AFA91_01980
    2.6.1.66  valine---pyruvate transaminase
     AFA91_01980
Amino acid related enzymes [BR:mgo01007]
 Aminotransferase (transaminase)
  Class I
   AFA91_01980
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Beta_elim_lyase Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: AKS30848
UniProt: A0A0K0X0M2
LinkDB All DBs
Position
405400..406674
Genome map
AA seq 424 aa AA seqDB search
MERVTTHQLPWQSTGEHRKPRTFTQSTKLQDVLYEIRGPVHEHASRLEAEGHRILKLNIG
NPAPFGFEAPDVIMRDMIQALPTAQGYSDSKGILSARRAVFTRYELVEGFPKFDVDDVYL
GNGVSELITMTLQALLDNGDQVLIPAPDYPLWTASTSLAGGTPVHYLCDETQGWNPDVAD
IEAKITERTKAIVVINPNNPTGAVYSRETLEQIVDLARRHQLLLLADEIYDKILYDDAEH
ISLATLAPDLLCLTFNGLSKAYRVAGYRSGWLVITGPKEHATSFIEGISLLANMRLCPNV
PAQHAIQVALGGHQSIEQLVLPGGRLLEQRDVAWEKLNEIPGVSCVKPRGALYAFPRLDP
EVHEIQDDEQLVLDLLLQEKILLTQGTGFNWPTPDHLRIVTLPWARDLAAAIERLGNFLA
SYRQ
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atggaacgcgtgaccacccatcagttgccgtggcagagcaccggtgagcaccggaagccg
cgcacgttcacccagtccacgaagctgcaggacgtcctgtacgagatccgtggaccggta
cacgagcacgcctcacggctggaagctgaagggcatcgcatcctcaaactgaacatcggc
aaccccgcgccgttcggcttcgaggctccggacgtgatcatgcgcgacatgatccaggcc
ctgccgaccgcgcagggctattccgactccaagggaattctcagcgcccgccgcgcggtg
ttcacccgctacgagctcgtcgagggcttccccaaattcgacgtcgacgacgtctatctg
ggcaacggcgtctccgagctgatcaccatgaccctgcaggcgctgctggacaacggcgat
caggtgctcatcccggcgccggactacccgctgtggaccgcctcgacctcgctggccggc
ggcaccccggtgcactacctgtgcgacgagacgcagggttggaaccccgacgtcgccgac
atcgaagccaagatcaccgaacgcaccaaggcgatcgtggtgatcaacccgaacaacccg
accggcgcggtgtacagccgcgagacgctcgagcagatcgtcgacctggcgcgccggcat
cagctgctgctgctggccgacgagatctacgacaagatcctctacgacgacgccgagcac
atctcgctggccacgctggcgccggacctgctgtgcctgacgttcaacgggctgtcgaag
gcctaccgggtggccggttaccgatccgggtggctggtgatcaccggccccaaggaacac
gccaccagcttcatcgagggcatcagcctgctggccaacatgcggctgtgccccaacgtc
ccggcccagcatgcgatccaggtggccctcggtggccatcagagcatcgagcagctggtg
ctcccgggtgggcggctgctcgaacagcgcgacgtggcgtgggagaagctcaacgagatc
cccggggtgtcgtgtgtgaagccgcgcggcgcgttgtacgcgttcccgcggctcgatccc
gaggtgcacgagatccaggacgacgagcaactggtgctcgacctgctgttgcaggagaag
atcctgctcacccagggcaccgggttcaactggcccacaccggatcacctgcgcatcgtg
acgctgccgtgggcgcgagacctcgccgccgcgatcgagcggttggggaacttcctggcg
agctaccgccagtag

DBGET integrated database retrieval system