KEGG   Mycolicibacterium goodii: AFA91_03775Help
Entry
AFA91_03775       CDS       T04008                                 

Definition
(GenBank) ATP-dependent DNA ligase
Organism
mgo  Mycolicibacterium goodii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C
Motif
Other DBs
NCBI-ProteinID: AKS31147
UniProt: A0A0K0X1C6
LinkDB All DBs
Position
complement(779656..780738)
Genome map
AA seq 360 aa AA seqDB search
MGRMDLPVQPPIEPMLAKAQVKVPDDAGVWSYEPKWDGFRALVFRDGDDVVLQSRNGKEL
GRYFPELLDALRDELVDRCVLDGEVVVPREIAADARSKTGRGRIRLDWESLSQRIHPAQS
RITMLAQQTPAHFIGFDALATGDRSLLKEPFRVRREALAEAVNKKRWCHVTRSTEDPALA
TEWLKTFEGAGLDGVIAKRLDGPYLPGKREMVKVKHHRDADCVAMGYRIHKSGEGIGSIL
LGLYRDDGELQMVGGAASFTAKDRLKLLRELEPLREGDEMREGDPSRWNSAADKRWIPLR
PEKVCEVAYDQMEGNSVEGRRFRHAVKFLRWRPDRDPSSCTFDQLDTPLNYDLYDVLEAQ
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgggaaggatggacttgccggtgcagcccccgatcgagccgatgcttgccaaggcgcag
gtgaaggtgcccgacgacgccggggtgtggtcctacgagccgaaatgggacggtttccgt
gccctggtgttccgcgacggcgacgacgtggtgttgcagtcccgcaacggcaaggagctg
ggccgctacttccccgaactgctcgatgcgctgcgtgacgaactcgtcgaccgctgcgtg
ctcgacggtgaggtggtggtgccccgggagatcgccgcggacgcgaggagcaaaacaggc
agaggccggatccggctggactgggagtcgctgagccagcgcatccatcccgcgcagagc
cgcatcacgatgctcgcccagcagaccccggcgcacttcatcggattcgacgcgctcgcc
acgggtgaccggtcactgctcaaagaaccgttccgggtgcgccgcgaggcgctggccgag
gccgtcaacaagaaacggtggtgccatgtcacccgcagcaccgaggaccccgcgctggcc
accgaatggctgaaaacctttgagggcgccgggctcgacggggtgatcgccaaacggctc
gacgggccgtacctgcccggcaagcgggagatggtcaaggtcaaacaccaccgcgacgcc
gactgcgtcgcaatgggttaccgcatccacaagagcggtgagggcatcgggtcgatcctg
ctgggcctgtaccgcgacgacggcgagctgcagatggtcggcggcgcagcgtcgttcacc
gcgaaagaccggctcaagctgctgcgggaactcgagccgctgcgcgagggcgatgagatg
cgcgaaggcgaccccagccggtggaactcggcggccgacaagcggtggatcccactgcgc
cccgagaaggtgtgcgaggtggcctacgaccagatggagggaaactcggtcgagggcagg
cgcttccggcacgccgtgaagttcctgcgctggcggccggaccgggatccgtcgagttgc
acgttcgaccagttggacaccccgttgaactacgacctctatgacgtgctggaggcacag
tga

DBGET integrated database retrieval system