KEGG   Mycolicibacterium goodii: AFA91_03780Help
Entry
AFA91_03780       CDS       T04008                                 

Gene name
ligC
Definition
(GenBank) ATP-dependent DNA ligase
Organism
mgo  Mycolicibacterium goodii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C
Motif
Other DBs
NCBI-ProteinID: AKS31148
UniProt: A0A0K0X1I4
LinkDB All DBs
Position
780789..781868
Genome map
AA seq 359 aa AA seqDB search
MDLPVLPPVSPMLSKSVDEIPPGMSYEPKWDGFRSILFRDGAEVELGSRKERPMTRYFPE
LVAAALTELPHRCVIDGEIVLPTDHRLDFEALQLRLHPAASRVAMLAAQTPAAFIAFDLL
ALGDDDYTARPFTGRRAALEAALAGAGRTFHLTPATTDLPTAQRWFHEFEGAGLDGVIAK
PLDLTYQPDKRVMFKVKHQRTADCVVAGYRLHKSGADAVGSLLLGLYDDAGELASVGVIG
AFPMATRRTLFTELQPLVTDFDTHPWNWAAQAAADPELARRYGGGSRWNAGKDLSFVPLR
PQRVVEVRYDHMEGRRFRHTAQFNRWRPDRDARSCTFAQLDTPTVFDLGDIVPGLAEPQ
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atggacctgcccgtgctgccaccggtatcgccgatgctgtcgaaatccgtcgacgagatc
ccgcccggaatgtcgtatgaacccaagtgggacggcttccggtcgatcctgttccgcgac
ggcgccgaggtggaactcggcagccgcaaggaacggccgatgacccggtatttccccgaa
ctcgtcgccgccgcgctcaccgaactgccgcaccgctgcgtgatcgacggggagatcgtg
ctaccgacggaccaccgcctcgacttcgaggcgctgcagctgcgcctgcacccggccgcg
agccgggtggcgatgctcgccgctcagacgcctgcggcgttcatcgcgttcgatctgctg
gcgctcggcgacgacgactacaccgccaggccgttcaccgggcgtcgcgccgcgctcgag
gcggccctcgcgggcgccgggcggacgtttcacctcacaccggccaccaccgatctgccg
accgcgcagcgctggttccacgagttcgaaggcgcgggtctcgacggggtcatcgccaag
cccctcgacctgacctatcagccggacaaacgcgtgatgttcaaggtcaagcaccaacgc
accgcggattgcgtggtcgcgggctatcggctgcacaagtccggcgccgacgcggtgggt
tcgctgctgctgggcctctacgacgacgccggcgagctcgcctccgtcggcgtcatcggc
gcgttcccgatggcgacgcggcggacgctgttcaccgaactgcagccgctggtcaccgat
ttcgacacccacccgtggaactgggccgcgcaggccgccgccgacccggaactggcgcgc
cgctacgggggcgggtcacggtggaacgcgggcaaggacctgtcatttgtcccgctgcgc
ccgcaacgggtggtcgaggtgcgctacgaccacatggagggccgccggttccgccacacc
gcccagttcaaccgctggcgcccggaccgcgacgcgcgctcgtgcacgttcgcccaactc
gacacccccacggtcttcgacctcggcgacatcgtgcccgggctagccgaaccgcagtga

DBGET integrated database retrieval system