KEGG   Mycolicibacterium goodii: AFA91_25065Help
Entry
AFA91_25065       CDS       T04008                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase / 5-aminovalerate transaminase [EC:2.6.1.19 2.6.1.22 2.6.1.48]
Organism
mgo  Mycolicibacterium goodii
Pathway
mgo00250  Alanine, aspartate and glutamate metabolism
mgo00280  Valine, leucine and isoleucine degradation
mgo00310  Lysine degradation
mgo00410  beta-Alanine metabolism
mgo00640  Propanoate metabolism
mgo00650  Butanoate metabolism
mgo01100  Metabolic pathways
mgo01120  Microbial metabolism in diverse environments
Module
mgo_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:mgo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    AFA91_25065
   00650 Butanoate metabolism
    AFA91_25065
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AFA91_25065
   00280 Valine, leucine and isoleucine degradation
    AFA91_25065
   00310 Lysine degradation
    AFA91_25065
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AFA91_25065
Enzymes [BR:mgo01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     AFA91_25065
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     AFA91_25065
    2.6.1.48  5-aminovalerate transaminase
     AFA91_25065
Amino acid related enzymes [BR:mgo01007]
 Aminotransferase (transaminase)
  Class III
   AFA91_25065
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: AKS34622
UniProt: A0A0K0XB85
LinkDB All DBs
Position
5358764..5360104
Genome map
AA seq 446 aa AA seqDB search
MSHPEQSRHLATAIPGPGSRALIDRKGAAVARGVGTTMPVYAARAGGGIVEDVDGNRLID
LGSGIAVTTVGNSSPRVVEAVRAQVTDFTHTCFMVTPYEGYVAVCEQLNRLTPVRGEKRS
ALFNSGSEAVENAVKIARSHTHKPAVVAFDHAYHGRTNLTMALTAKVMPYKHGFGPFAPE
IYRAPLSYPFRDAEFGKELATDGELAAKRAIDVIDKQIGADNLAAVVIEPIQGEGGFIVP
ADGFLPTLLDWCRNNGVVFIADEVQTGFARTGAMFACEHEGIDPDLIVTAKGIAGGLPLS
AVTGRAEIMDSPHVSGLGGTYGGNPIACAAALAVIETIEADGLVARARQIEGLMKDRLGR
LQAEDDRIGDVRGRGAMIAMELVKAGTTEPDADLTKALCAGAHAAGVIVLSCGTYGNVVR
FLPPLTISDELLNEGLDVLEEVLRGA
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
gtgagccaccccgaacagagccgccatctcgccaccgcaatccctggccccggatcccgg
gcgctgatcgaccgcaagggcgctgcggtcgcccgcggcgtcggcacgaccatgccggtc
tacgcggcccgcgccggcggcggcatcgtcgaggacgtcgacggcaaccggctgatcgac
ctcggttccggcatcgccgtgaccaccgtcggcaactcttcgcccagagtcgtcgaggcg
gtgcgtgcccaggtcaccgacttcacccacacctgcttcatggtgaccccgtacgagggc
tacgtcgcggtctgcgagcagctcaaccggctcaccccggtgcgcggcgagaagcgctcg
gcgctgttcaactccgggtccgaggcggtcgagaacgcggtcaagatcgcgcggtcgcac
acccacaagccggccgtggtggcgttcgaccacgcctatcacggccgcaccaacctgacc
atggcgttgacggccaaggtcatgccgtacaaacacgggttcgggccgttcgcgccggag
atctaccgggcgccgctgtcctatcccttccgcgatgccgagttcggcaaggaactggcc
accgatggcgagctggcggccaagcgcgccatcgacgtgatcgacaagcagatcggcgcc
gacaatctcgccgcggtcgtcatcgagccgatccagggcgagggcggcttcatcgtgccc
gccgacggattcctaccgacgctgctcgactggtgccgtaacaacggtgtggtgttcatc
gccgacgaggtgcagacgggtttcgcgcgcaccggcgcgatgttcgcgtgtgagcacgag
ggcatcgaccccgacctgatcgtcaccgccaagggcatcgccggcggtcttccgctgtcg
gcggtgaccggacgcgccgagatcatggattccccgcacgtgtccgggctgggcggcacc
tacggcggcaacccgatcgcgtgcgcggccgcgctggcagtcatcgagaccatcgaggcc
gacggcctggtggcgcgggcccggcagatcgaggggctcatgaaggaccggctgggccgg
ctgcaggccgaggacgaccggatcggcgatgtccgtggccgcggcgcgatgatcgccatg
gaactggtcaaggccggcaccaccgaacccgatgccgacctgaccaaggcgctctgcgcg
ggcgcacacgccgcgggggtgatcgtcttgtcttgcggcacttacggaaacgtcgttcgc
ttcctgccgccgctgacgatcagcgatgaactgctcaacgagggtctggatgtcctcgag
gaggtactccgcggtgcgtga

DBGET integrated database retrieval system