KEGG   Mycolicibacterium goodii: AFA91_31050Help
Entry
AFA91_31050       CDS       T04008                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
mgo  Mycolicibacterium goodii
Pathway
mgo00473  D-Alanine metabolism
mgo01100  Metabolic pathways
mgo01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:mgo00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    AFA91_31050
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    AFA91_31050
Enzymes [BR:mgo01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     AFA91_31050
Peptidoglycan biosynthesis and degradation proteins [BR:mgo01011]
 Precursor biosynthesis
  Racemase
   AFA91_31050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: AKS35615
UniProt: A0A0K0XDZ7
LinkDB All DBs
Position
complement(6642404..6643576)
Genome map
AA seq 390 aa AA seqDB search
MQTIEPMTPLTPQASAQAVIDLGAVDHNVRVLRELAGSADVMAVVKADAYGHGALPVART
ALAAGAAALGVATIPEALALREGGITAPVLAWLHPPGTDFAPAIAADVEVAVSSRKQLEA
VLAAADEVGRTAAVTVKVDTGLSRNGVSATDYPAVLDVLRRAQADGAIVVHGLMSHLVHG
DDPENPFNDLQAQRLTDMRAFAREHGVDFQVAHLCNSPAAMTRPDMAFEMVRPGIALYGL
SPIPERGDMGLRPAMTLKCPVALVRSVRTGDGVSYGHRWVADRDTTLALLPIGYADGVFR
ALSGRIDVLIKGRRRRAVGRICMDQFVVDLGPDATDVTVGDDAILFGPGTQGEPTAQDWA
ELLDTIHYEIVTSPRGRVTRTYVPVGRDIG
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgcagaccatcgagcccatgacaccgctgaccccacaggcgtcggcgcaggcggtgatc
gatctgggcgccgtcgaccacaacgtgcgggtgctgcgcgaactcgccggttccgcggat
gtcatggccgtggtcaaggccgacgcctacggacacggggcgctgccggtggcccgcacc
gcgctggccgccggggccgccgcactcggcgtcgcgaccattcccgaggcgctcgcgctg
cgtgagggcggcatcaccgcgccggtcctggcgtggctgcatccgcccggcaccgatttc
gccccggccatcgccgccgatgtcgaggtcgcggtgtcgtcgcgcaaacagctcgaagcg
gtgctggcggccgcggacgaggtgggccgcaccgcggccgtcacggtcaaggtcgacacc
gggctcagccgcaacggcgtcagcgccaccgactatccggcggtgctcgacgtgctgcgt
cgcgcccaggccgacggcgcgatcgtggtgcacggcctcatgagccacctggtgcacggc
gacgatccggagaatccgttcaacgatctgcaggcgcagcggttgaccgatatgcgggcc
ttcgcccgcgagcacggcgtggactttcaggtggcgcacctgtgcaactcgcccgcggcg
atgacccggcccgacatggccttcgagatggtgcgccccggcattgcgctgtatggcctg
agccccatcccggagcgcggcgacatgggcctgcgacccgcaatgaccctgaaatgcccg
gtggcgcttgtccgttcggtgcgcacgggcgacggggtgtcctacgggcaccggtgggtg
gccgaccgtgacaccacgttggcgctgctgccgatcggctacgccgacggcgtgttccgc
gccctgagcggacgtatcgacgtgctgatcaagggcaggcggcgacgcgccgtcggccga
atctgcatggaccagttcgtcgtcgacctcggacccgacgccaccgacgtcaccgtgggt
gacgacgcgatcctgttcgggcctggcacgcagggtgagccgaccgcgcaggattgggcc
gaactgctcgacaccatccactacgagatcgtgacgagcccgcgtggacgcgtcacccgc
acctacgttccggtgggacgagatattgggtaa

DBGET integrated database retrieval system