KEGG   Mycolicibacterium goodii: AFA91_31595Help
Entry
AFA91_31595       CDS       T04008                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K22187  alpha-ketoglutaric semialdehyde dehydrogenase [EC:1.2.1.-]
Organism
mgo  Mycolicibacterium goodii
Pathway
mgo00040  Pentose and glucuronate interconversions
Brite
KEGG Orthology (KO) [BR:mgo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    AFA91_31595
Enzymes [BR:mgo01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     AFA91_31595
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AKS35709
UniProt: A0A0K0XE69
LinkDB All DBs
Position
complement(6749314..6750759)
Genome map
AA seq 481 aa AA seqDB search
MSAVEGANFIDGQWVPAASGRTFARYNPADPDDLVGTFPASDDVDVRTAVDALDKAAPEW
AATPPERRAAILEAAATQLESRAQALIDELVREEGKTVAEATMEVTRTPANLRFYAGEAL
RCTGATYPVAGEALVYTLREPVGIVGAITPWNFPFNIPSRKLGPALAAGNPVLYKPSEIT
PLMGQRLVEALLDGGLPPSALALVQGDGVAGAAVTADPRVAAVTFTGSTAVGRAIHQQVG
PQRRVQLEMGGKNPVVVAEDADLDGAAALIVKGAFGLSGQACTGTSRVIAVDAIHDALLE
RVAARADALTVGPGDEPGVQMGPLASSDQMEKFLRYVHIGITEGATLRCGGTTAGDRGFF
VRPAVFADALPTMRIVTEEVFGPLVAFQRAMDLDEAVALANATEYGLAASIVTSDLAAAT
RFARQSKTGLVKINQPTTGMAMNAPFGGYKASSTQTHKEQAGPTLMEFYTLEKTVYLTPA
V
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgctgtcgagggagccaacttcatcgacgggcaatgggttccggccgcgtcgggg
cggacgttcgcgcggtacaacccggccgaccccgacgatctcgtcggcaccttcccggcg
tccgacgacgtcgacgtgcgcaccgccgtcgacgcactcgacaaggccgcgcccgagtgg
gccgccacgccgccggagcgccgcgcggcgatcctggaagccgctgccacacagctggaa
tcgcgtgcccaggcattgatcgacgagctggtgcgggaagagggcaagaccgtcgccgag
gccaccatggaggtcaccaggaccccggcgaacctgcgcttctacgccggcgaggcactg
cgttgcaccggcgccacctaccccgtcgcgggggaggcgctggtctacaccctgcgcgag
cccgtcggcatcgtcggtgccatcacaccgtggaacttcccgttcaacatcccgtcccgc
aagctcgggcccgcgctggcagccggaaatcccgtgctgtacaagccgtcggagatcaca
ccgctcatggggcagcgtctggtcgaggcgctgctggacggtggtctgccgccgtcggcg
ctcgcgctggtccagggtgacggcgtggcgggcgccgcggtcaccgccgatccgcgggtc
gcggcggtcaccttcaccggatcgacggcggtcggccgcgcgatccaccagcaggtgggc
ccgcagcgccgcgtccagctggagatgggcggcaagaaccccgtcgtggtcgccgaggac
gcggacctcgacggcgcggccgcactgatcgtcaagggtgccttcgggctcagcggacag
gcctgcaccggtaccagccgggtcatcgccgtcgacgcgatccacgacgccctgctggaa
cgagtggcggccagggccgacgcgctgaccgtcggccctggcgacgaacccggcgtgcag
atggggccgctcgcgagttccgaccagatggagaaattcctgcgctacgtgcacattggg
atcaccgagggcgcgacactgcgctgcggcggcaccacggccggcgatcgcggattcttc
gtccgcccagcggttttcgcagatgcgctgcccaccatgcgcatcgtcaccgaggaagtg
ttcggaccgctggtcgccttccagcgcgcgatggacctcgacgaggccgtcgcactggcc
aacgccaccgaatacggcctggccgcctcgatcgtgacctcggatctcgccgcggcaacc
cggttcgcccggcagtcgaagaccggactggtcaagatcaaccagcccacgaccggcatg
gccatgaacgcacccttcgggggctacaaggcgtcgagcacccagacccacaaggaacag
gccgggccgacgctcatggagttctacacgctcgaaaaaaccgtctacctcactccggcc
gtctga

DBGET integrated database retrieval system