KEGG   Mucilaginibacter gotjawali: MgSA37_00349Help
Entry
MgSA37_00349      CDS       T05131                                 

Gene name
sodA
Definition
(GenBank) Superoxide dismutase [Mn]
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
mgot  Mucilaginibacter gotjawali
Brite
Enzymes [BR:mgot01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     MgSA37_00349 (sodA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: BAU52199
UniProt: A0A110B004
LinkDB All DBs
Position
370031..370636
Genome map
AA seq 201 aa AA seqDB search
MAFTLPALPYATDALEPHIDKMTMEIHHGKHHQAYVTNLNKALEGKPEADSNIEDIIKNI
SKFPMAVRNNGGGHFNHSLFWTILGPGAGGEPTGALGDAIKSTFGSFADFKTKINEAGAT
RFGSGWAWLIVTPEKKLAVCSTPNQDNPLMDIAEVKGTPIFGIDVWEHAYYLKYQNRRPD
YLAAIWNVINWNHVAELYSKA
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atggcttttacactaccggcgttaccttacgctaccgacgcgcttgaaccgcatattgat
aaaatgaccatggaaattcaccatggcaaacatcaccaggcttatgttaccaatttaaat
aaagcactggaaggaaaaccagaagccgacagcaatattgaagatatcattaaaaatatc
tccaaattcccgatggctgtccgcaataatggtggtggccactttaaccacagcttattc
tggaccatattaggccccggagcaggtggcgagcctaccggcgcgcttggcgatgcaatt
aaaagcaccttcggctcatttgccgattttaaaactaaaattaacgaagcaggcgcaacc
cgctttggttcaggctgggcatggctgatcgttacaccagaaaaaaaactggctgtatgc
tcaacgccaaaccaggataacccattgatggatatagctgaagtaaaaggtaccccgata
ttcggcatagacgtttgggagcatgcttattatttgaaataccaaaaccgccgcccggac
tacctggcagctatttggaacgtgatcaactggaaccacgttgccgaattgtatagcaaa
gcgtag

DBGET integrated database retrieval system