KEGG   Mucilaginibacter gotjawali: MgSA37_01758Help
Entry
MgSA37_01758      CDS       T05131                                 

Definition
(GenBank) Alpha-amylase precursor
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
mgot  Mucilaginibacter gotjawali
Pathway
mgot00500  Starch and sucrose metabolism
mgot01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mgot00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    MgSA37_01758
Enzymes [BR:mgot01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     MgSA37_01758
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase DUF1939
Motif
Other DBs
NCBI-ProteinID: BAU53589
UniProt: A0A0X8X4T6
LinkDB All DBs
Position
complement(1843820..1845217)
Genome map
AA seq 465 aa AA seqDB search
MKRQFYRLGRASIFLALLLTFSQCKKSAVTENAPAAAKISKTFVNDATPGPGGGVLMQAF
YWNTPNTSSWWQNVNSKIAAWDAAGISAIWLPPATKGQSGGSSMGYDPYDYFDFGTYNQM
GSTTTRFGNLADLNTLISNAHTHNIQVYADMVLNHCSGGTLEANPYTGTNTYTKFTPLSG
QFNRSYSDFHPNNIHASDEGSFGGFPDLCHAQANVSNWIYNASYSMSRYYKNTMHYDGWR
FDYVKGFGAWVVQNYVNSVGGFAVGEDWDGNAANLQSWVNATGGTSSAFDFACFYAMHSA
FDSNDLTHLNDDMLWKRNGAKSVTFVSNHDTDIIGNKYSAYAYIMTHEGYPCVFYSDYEQ
WLDKGRMNNLIWIHRTLAGGTTTNLYSASDQYIDRRNGYGAAPGVIVYFNGTGYWQQQWV
TSNWANRQIKEYTGASGWVQTVAADGRVLIQAPPNSYSIWSVTGY
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagacaattctaccgtttgggccgggcatcaatcttcctggcattattattaact
ttttcgcaatgcaaaaagtcggcggtgaccgaaaacgcacctgctgctgcaaaaatctcc
aaaacatttgttaacgatgcaacgccaggccctggcggcggcgtgttaatgcaggccttt
tactggaacacgcccaacacctcctcctggtggcaaaatgtaaacagcaaaatagcagca
tgggatgcggcaggcatctcggccatctggcttccgcctgctaccaaagggcaaagcggc
ggttcaagtatgggttacgatccctatgattattttgactttggcacgtataaccaaatg
ggatctacgactacacgcttcggcaacctggcagaccttaataccctgatctccaatgcg
cacacccataacattcaggtatatgcggatatggtgttaaaccactgcagcgggggtaca
ctggaagccaacccttataccggcaccaatacttacaccaaatttacgccgctgtcgggg
caattcaacaggagctacagcgatttccaccccaacaatatccatgcatctgatgaaggc
tcattcggaggctttcctgacctttgccacgcacaggctaatgtttccaattggatctat
aatgcatcatacagtatgtcaagatactacaaaaacaccatgcactatgacggatggcgc
tttgattacgtaaagggttttggggcatgggtggtgcaaaactatgtaaacagcgtgggc
ggctttgcagttggcgaagactgggatggcaacgcagccaatttacaaagctgggtaaat
gctaccggcggcacctcgtcggcttttgactttgcctgcttttatgccatgcactctgct
tttgacagcaacgacctcacccatttaaacgatgacatgctttggaaaagaaacggcgcc
aaatccgttactttcgtttccaatcatgatactgacattatcgggaataaatattcggcc
tatgcctatattatgacgcatgaaggttatccttgtgtattttacagcgattatgaacaa
tggcttgataaaggcagaatgaataacctgatctggatccaccggacgctggcaggcgga
acaacaaccaacttatattcagcaagtgaccagtatatcgaccggcgcaacggttacggt
gcggcgccaggcgtaatcgtatattttaacggaacaggctactggcaacagcaatgggta
accagtaactgggccaacaggcaaattaaagaatacaccggcgcctccggctgggtacaa
actgttgccgccgatggcagggttttaatccaggcaccgccaaattcttattctatctgg
tcagttacaggttattga

DBGET integrated database retrieval system