KEGG   Mucilaginibacter gotjawali: MgSA37_02379Help
Entry
MgSA37_02379      CDS       T05131                                 

Gene name
alr
Definition
(GenBank) Alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
mgot  Mucilaginibacter gotjawali
Pathway
mgot00473  D-Alanine metabolism
mgot01100  Metabolic pathways
mgot01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:mgot00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    MgSA37_02379 (alr)
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    MgSA37_02379 (alr)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:mgot01011]
    MgSA37_02379 (alr)
Enzymes [BR:mgot01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     MgSA37_02379 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:mgot01011]
 Precursor biosynthesis
  Racemase
   MgSA37_02379 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C Mur_ligase_M Mur_ligase Mur_ligase_C
Motif
Other DBs
NCBI-ProteinID: BAU54207
UniProt: A0A110B356
LinkDB All DBs
Position
complement(2579011..2581473)
Genome map
AA seq 820 aa AA seqDB search
MSSNQYPISAIQQIIKAGGNIVKEYNISSLITDSRRIGNAAEGLFFALSGRRNGHEFIAE
AYAAGVRNFVVKEGPQLIMPEANFLIVTDVLQALQTLAAHHRSSFNLDVIGITGSNGKTI
VKEWLYQLLCTDKNIVRNPKSYNSQIGVPLSVWQINVKNNLGIFEAGISTRNEMVRLETI
IRPSIGVLTHIGTAHDEGFASRDEKVKEKLLLFKNCRLLIHNYEQLMDFKEDISVKDCFT
WSTKFKQADLYVFSETVIKRNTYLRARYKGDEIECLIPFMDGASVENAIVCWAVMLAMGY
SAAETDDRIEHLNPVSMRLELKTGINDCSVIDDSYNSDVQSLEIALNFLNQQNQHTKKTL
ILSDIFQSGLQPDVLYKQVAEMIKAKHVDKFVGVGKALSKYQEDFDIPVKHFYPDTPSML
QHLRALNFKEETILIKGSRSFEFESISRALVQKAHETVMEINLNAMVNNLNFYRSKLKPG
VKVMAMVKAFSYGSGTFEVANILQYNKVDYLAVAYIDEGVALRKTGITLPVMVLNPEASA
FDKLTEYNLEPVIYSFGLFDDYIKYARQQNVLDYPVHLKIDTGMHRLGFENFEVETLCDL
LEENRYVNIRSVFSHLVASDAAEHDEFTKTQVRNFEKAFKLIEKALGYKVIRHLCNTSGI
VRWPNAQYDMVRLGIGLYGIDAATPATENGLQPIASLKTSVSQVKNITNGDTISYNRSGK
LGNNGKIATVRIGYADGYLRAFGNGVGKMLVKGTLVPTVGNITMDMCMLDVSDIDVKEGD
EVIVFNEQQRIEALAEQIGTIPYEILTNISQRVKRVYFYE
NT seq 2463 nt NT seq  +upstreamnt  +downstreamnt
atgtccagtaatcaataccctatttcggcaattcagcagatcattaaggccggcggcaat
attgtaaaagagtataacatcagttcgttgatcaccgacagccggcggataggcaatgcc
gccgaaggcttgttttttgcgttgagcggccgccgcaacggacatgaatttattgctgaa
gcttatgctgccggggtacgcaattttgttgttaaagaaggcccgcaactgataatgccg
gaggccaactttttgatcgtaaccgacgtgctgcaggctttgcaaacgttggcggcgcat
caccgcagcagtttcaaccttgacgttataggcataacgggcagtaacggcaaaaccatt
gttaaggaatggctttaccagttgctgtgcacagataaaaacattgtacgcaaccctaaa
agttataactcgcaaataggcgtgccactttcggtatggcagatcaacgtaaaaaacaac
cttggaattttcgaagccgggatctccacccgcaacgagatggtaaggcttgaaactatc
atccggccatccattggcgtactaacgcatatcggtaccgcccatgacgaaggttttgca
agccgcgatgaaaaagtaaaagaaaagctgctgctttttaaaaactgtcgcctgctgatc
cataactacgagcagttgatggattttaaagaagatatctccgtaaaagattgctttacc
tggagcaccaaatttaaacaggcagacctgtacgttttcagcgaaacggttatcaaacgg
aatacttatttaagggcgaggtacaagggggacgaaattgaatgccttattccctttatg
gatggagcctcagttgagaatgcgattgtttgctgggccgtaatgctggcgatgggctat
tcggcagcagaaacagacgacaggattgaacaccttaacccggtaagcatgcggcttgaa
ttaaaaacaggcatcaatgattgttcggtaatagatgattcctataactcggatgttcaa
tcgctggaaattgccttgaattttttgaaccagcaaaatcagcataccaaaaaaacattg
atcttgtctgatatcttccagtcgggcttacagccagatgtgctgtataaacaggtggcc
gaaatgataaaggcgaagcatgtggataaatttgttggtgtaggcaaagcgctcagcaaa
taccaggaagattttgatatacctgttaaacacttttacccggatacgccatcgatgctg
cagcatctccgcgcccttaattttaaagaggaaaccatcctgataaaaggttcgcggagt
tttgagttcgaaagtataagccgtgcactggtgcaaaaggcgcacgaaacggtaatggaa
atcaacctgaatgccatggttaataaccttaatttttaccgaagcaaattaaagccgggt
gtaaaggtaatggccatggtgaaagcattctcttacggcagcggcacttttgaggtggcc
aatatcctgcagtacaacaaggttgattaccttgcagtagcctatattgacgaaggcgtt
gccttgcgtaaaaccggtatcaccctgccggtgatggtacttaacccggaagcttccgct
tttgacaaactgactgaatataacctggagccagtgatctatagttttggtctgtttgac
gattacatcaaatatgcccggcaacaaaacgtgttggattaccccgtacacctgaaaatt
gacaccggcatgcaccgcctgggctttgaaaattttgaggtggaaaccctttgcgacttg
ctcgaagagaacaggtatgtaaacatcaggtcggtattttctcatttggtggccagcgat
gctgcggagcacgatgaattcactaaaacccaggtgcgtaattttgaaaaagcatttaag
ctgattgaaaaagcactgggttataaagtgatcaggcacctttgcaatacttcgggcata
gtaaggtggccaaatgcgcagtatgatatggtaaggcttggtattgggctttatggtata
gatgccgcaacgccggcgaccgaaaacggattgcaacctatagccagtttaaaaacgagc
gtatcgcaggtaaaaaacattacgaacggagataccataagttataacaggagcggcaaa
cttggtaacaatggaaagatagccaccgtacggattggttatgccgacggctatttgcgc
gcatttggcaacggcgtaggcaagatgctggtaaaaggaacacttgtgcccaccgttggc
aatattacgatggatatgtgcatgcttgatgtgagtgatattgatgtaaaagaaggcgac
gaggtgattgtttttaacgaacagcaacgtattgaggcactcgcggaacaaatcggcacc
ataccctatgaaattttaaccaatatttcccagcgtgtaaaaagagtgtacttttatgaa
taa

DBGET integrated database retrieval system