KEGG   Mucilaginibacter gotjawali: MgSA37_02744Help
Entry
MgSA37_02744      CDS       T05131                                 

Gene name
kynU
Definition
(GenBank) Kynureninase
  KO
K01556  kynureninase [EC:3.7.1.3]
Organism
mgot  Mucilaginibacter gotjawali
Pathway
mgot00380  Tryptophan metabolism
mgot01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mgot00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    MgSA37_02744 (kynU)
Enzymes [BR:mgot01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.3  kynureninase
     MgSA37_02744 (kynU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_5
Motif
Other DBs
NCBI-ProteinID: BAU54568
UniProt: A0A110B5M9
LinkDB All DBs
Position
complement(2998908..3000182)
Genome map
AA seq 424 aa AA seqDB search
MIYQNTLAFATQLDEQDSLKGFQSKFLTPKHNGKDVIYLCGNSLGLQPVTAQSEVDQILK
NWQERAIEGFFTGDEPWLDFHKRLTYTLSQILGANRDEITIMNSLTVNLHLLMVSFYKPT
GNRFKIMMEGGAFPSDQYAIASQARFHGYDPKDAIIELFPRECEFTLRTEDIIRKINEHA
DDLALVLFSGVNYYTGQLFDMPAITTAAHGAGAFAGFDLAHAAGNVPLQLHEWGVDFATW
CSYKYMNSGPGGISGAFVNEKHFNNKKLNRFEGWWGFREDKRFLMPSVFEGEKGAAAWQL
STSPAILLALHKASLDIFEAAGGIAPLRAKSELLTGYLEFLINGINEKHGDELFKVITPG
YKADRGCQLSIVCKQNGKPTFDKLTENGVIGDWREPNVIRLSPVPLYNSFKQVFETGLIL
AAST
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgatctaccaaaacaccttagcattcgccacccagcttgatgagcaggattcgttaaag
ggttttcaatccaaatttcttacgccaaaacataacgggaaggacgtgatctacctttgc
ggcaattctctcgggcttcagcccgtaaccgcccagtccgaagttgaccagattttaaag
aactggcaggaacgtgccatagaaggattcttcacaggcgatgagccctggcttgatttt
cacaaaaggcttacttatacgctttcacagatacttggcgcgaaccgggacgaaataacc
atcatgaattcacttacagtaaatcttcatttactgatggtaagtttttataagccaacc
ggtaacaggtttaaaataatgatggaaggaggggcgtttccatcggatcaatatgcgatt
gccagccaggcaagattccacggctatgatccgaaagatgcgataattgaactgtttccg
cgggagtgtgaatttactttgagaacggaagacatcatccggaagataaatgaacatgcc
gacgaccttgcattggtgctttttagcggagtaaactactacacaggacagctgtttgat
atgccggcgataacgaccgcagctcatggcgccggagctttcgcgggtttcgacctggct
catgcggccgggaatgtcccgttacaacttcatgaatggggcgttgattttgccacctgg
tgttcatataaatacatgaattcgggcccgggaggaatcagcggcgcatttgtaaacgaa
aagcatttcaataataaaaaactcaaccggtttgaaggctggtggggcttccgcgaagat
aaacgctttttaatgccgtcggtatttgaaggagaaaagggggccgcagcctggcaacta
agtaccagcccggctatattgctggccttgcacaaagcttcgctggatatttttgaagca
gcgggcggcattgcaccgttgcgggcaaaaagcgaactgcttaccggctacctggaattt
ttgattaacgggattaatgaaaaacatggtgatgagctgtttaaagtcatcacgcccggc
tacaaggccgaccgcggctgccaattatctatagtttgcaagcaaaatggtaaaccaaca
tttgacaaactaacagaaaacggtgtaatcggcgattggcgcgaaccaaacgtgatcaga
ttaagccctgtaccgctttataacagctttaagcaagtttttgagactgggctgatattg
gccgcttcgacctaa

DBGET integrated database retrieval system