KEGG   Mucilaginibacter gotjawali: MgSA37_03160Help
Entry
MgSA37_03160      CDS       T05131                                 

Gene name
glpD
Definition
(GenBank) Aerobic glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
mgot  Mucilaginibacter gotjawali
Pathway
mgot00564  Glycerophospholipid metabolism
mgot01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mgot00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    MgSA37_03160 (glpD)
Enzymes [BR:mgot01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     MgSA37_03160 (glpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored HI0933_like Pyr_redox_2 GIDA NAD_binding_8 Pyr_redox_3 FAD_binding_3 Thi4
Motif
Other DBs
NCBI-ProteinID: BAU54980
UniProt: A0A0X8X3I9
LinkDB All DBs
Position
3474399..3475967
Genome map
AA seq 522 aa AA seqDB search
MPVIHREKLTCALNNPDKIWDVIIVGGGATGLGTALDAASRGYNTLLLEQADFAKGTSSR
STKLVHGGVRYLAQGDIGLVREALYERGLLLKNAAHLVKNESFIIPNYQWWKGAYYSFGL
TLYDLLAGKLSFGRSKHISKKETIDRLPGIKQQGLYGGVVYHDGQFDDARLAINLAQTCL
EQGATVLNYFKVTGLLKAGGKTTGVWATDMETGVAYQIKSKAVINATGVFVDELMQQDEP
HKKPLVRPSQGIHIVLDKSFMPGDDALMIPETDDGRVLFAVPWHGKLLIGTTDTPVDEHS
LEPRALEEEIGFVMRNVSRYLTNAPERKDVLSVFAGLRPLAAPQEGKKGTKEISRRHKII
VSASGLITITGGKWTTYRRMAQDTVDNAIETAGLDMRKCMTTNLPIHGNIKDVDRADHLY
VYGSDRDALLDLINENPEWAEKLHPDLDYIKAEVVWALRYEMARTVEDVLARRVRVLFLD
ARAAMEMAPVVAGLMAIELKKDKNWEVSQADEFIKLAKGYLL
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
gtgcccgttatccatcgtgaaaagctaacctgcgccctcaataaccccgataaaatctgg
gatgtcatcatcgttggcgggggtgcaacaggtttgggcaccgctttagatgcagcatca
cgcggctataacaccctacttctggaacaggccgatttcgctaaaggtacgtccagccgc
agcactaaactggtgcatgggggcgtgcggtatttggcgcagggtgatattggtttggtg
agagaggctttgtacgaacgcggcctgcttttaaaaaatgccgcacacctggtaaaaaat
gaatcatttattattccgaattaccaatggtggaaaggagcctactattctttcggctta
actttatatgacctgctggccgggaaactgagtttcgggcgatcaaaacatatctcaaaa
aaggaaaccattgacaggttgccgggcatcaaacaacagggcctttatggcggcgtagtt
taccacgacgggcagtttgacgatgcgcggctggcgatcaaccttgcccaaacctgtttg
gagcagggcgcaaccgttttaaactattttaaagttaccggtttactaaaagcggggggc
aaaactaccggtgtttgggcaacggatatggaaaccggcgtagcttatcaaatcaaaagc
aaagcggtgattaacgctacgggggtttttgtggatgaactgatgcagcaggacgaacca
cataaaaaaccgctggtcaggcctagccaggggattcatattgtgctcgataagtcgttt
atgccgggggatgatgcattgatgatccccgaaacggatgatgggcgggtactttttgcg
gtgccatggcatggaaaactattaattggcactacggatacacccgtcgatgaacatagc
cttgaaccgagggcgcttgaagaggagatcggtttcgtgatgcggaatgtaagcaggtat
ttaaccaacgcgcccgaacgaaaagatgtgctgagcgtatttgccgggttacgccctttg
gctgcaccgcaggaaggcaaaaagggcaccaaagagatctcgcgcaggcataaaatcatc
gtttctgcatccgggttgatcaccattaccgggggtaaatggaccacctatcgccgtatg
gcgcaggacaccgttgataatgcgattgaaaccgccgggcttgatatgcgaaaatgtatg
acgacgaacttaccgatccatggaaacattaaagatgtcgaccgcgccgatcacctgtat
gtttatggcagcgacagggatgctttacttgatctgattaacgaaaatccggaatgggca
gaaaaattgcatcctgatttagattatatcaaagccgaagtagtttgggccctgcgctat
gaaatggcccggacggttgaagatgtgcttgcaaggcgggtgagggtgcttttcctggat
gccagagccgctatggaaatggcgccggttgtagccggcttaatggccatcgaactaaaa
aaagataaaaattgggaagtaagccaggccgacgaatttattaaattggccaaaggctac
ctgctataa

DBGET integrated database retrieval system