KEGG   Mucilaginibacter gotjawali: MgSA37_03173Help
Entry
MgSA37_03173      CDS       T05131                                 

Gene name
ppc
Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
mgot  Mucilaginibacter gotjawali
Pathway
mgot00620  Pyruvate metabolism
mgot00680  Methane metabolism
mgot01100  Metabolic pathways
mgot01120  Microbial metabolism in diverse environments
mgot01200  Carbon metabolism
Module
mgot_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:mgot00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    MgSA37_03173 (ppc)
  09102 Energy metabolism
   00680 Methane metabolism
    MgSA37_03173 (ppc)
Enzymes [BR:mgot01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     MgSA37_03173 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: BAU54993
UniProt: A0A0X8X4L7
LinkDB All DBs
Position
complement(3486724..3489306)
Genome map
AA seq 860 aa AA seqDB search
MPLNLKLSHRETAFNNEVVMRFELYNSLFQTLPFYQVKDTGILLPFFSSHCEKETNKLIS
PTAIIESFFKKYVPDIDHREQINRMFRFIQYIERQVVLFDAIEDSSFNKLGRADDTGTLQ
VLTQQAAVSQDARNEISAKLNDFSLRLVLTAHPTQFYPGTILGIMTDLIEALKTNDINTI
DVLLQQLGKTPFFNKTSPTPVDEAISLAWFLENIFYHAVSGIQSKLDEEFDINPERHNQL
LELGFWPGGDRDGNPNVTTEITKSVASFLRQRAFRCYYRDYRVLKRRVTFRGVEKAMADL
DKLIYSNANFKQDDRDLQPEILELLRSIRHTLVADHDSLFVNLVDDLIRKVSLFGCYFAT
LDIRQDSRVLRKVFKFCTTNSGIDTGIPNGFLDFSEEEKIKNIVFNEANIVCPEDEDKLI
CDTLNTIRLMKEIQYTNGEKACQRFIISNCQQASDILQLMDLFLWSGWKKENLSVDFMPL
FEMVNDLKSAAQVMETLYTHPVYKEHLARRGNVQTIMLGFSDSTKDGGYLMANWSIYNAK
VELTAMARKYGIDLAFFDGRGGPPARGGGKTHRFYASMGDEIANKHIQLTIQGQTVSSQY
GSVETARFNMEQLINAGVISALQPNPNDLLDVKHKALISDMAEESYQLFLELRQHPLFVE
YLEKFSPLKLLSHINISSRPTKRNSDAALKLEDLRAISFVTSWSQLKQSIPGFYGVGTAL
NKMKEAGNWNEVKDLYNSSGFFKTMVDNCVMSMTKSDFRVTAYLEKDKKFGPFWKMLRDE
YELTKAMLLELTGTTMLMGEYPVERRSIAIREKIVLPLVIMQHYALHCLNNNPDEELAKI
YNKLVIRTVYGIVNAGRNLA
NT seq 2583 nt NT seq  +upstreamnt  +downstreamnt
atgcccttaaacttaaaactcagccacagagaaacagcttttaacaatgaagttgtaatg
cggtttgagttatataatagtttgtttcaaaccctgccgttttaccaggttaaggataca
ggtattttgctgccgttttttagttcccattgcgaaaaggaaaccaataaactaatatcc
ccaaccgccattattgaatcgtttttcaaaaaatatgtgcccgatatcgatcaccgcgag
caaatcaaccgcatgtttcgctttatacaatacatcgaacggcaggtggttttgtttgac
gctatcgaagattcttcctttaataaattgggcagggctgatgatactggtacactccag
gttttaacgcaacaggcggcagtaagccaggatgcccgaaacgagatcagtgcaaaactg
aatgatttttcattacggctggtgttaacggcacaccctacccaattttatccgggtacc
atccttggaataatgaccgacctgattgaagcattaaaaacaaacgatatcaacaccatc
gacgttttattgcaacagttaggtaaaacgccattttttaataaaacatcccccacaccg
gttgacgaagcgatcagcctggcctggttcctcgaaaatatattttaccatgctgtttcg
ggcatacaatcaaagctggatgaagagtttgatatcaaccctgaacgccataaccaatta
cttgaattgggcttttggcctggcggcgacagggacgggaatcctaacgttactaccgaa
attacaaagtcggtggcgagttttttaaggcagcgcgcgttcagatgctactaccgcgat
tatagggtgttgaaaagacgcgttacttttcgcggggtggagaaagccatggccgacctg
gataaactgatctattcgaacgctaactttaaacaggatgacagggatctgcaacccgaa
atactggaattactgaggtcgatcaggcatactttggtggccgatcacgatagccttttt
gttaatcttgttgatgatctgattcggaaagtgagcctttttggatgctattttgcaacg
ctagacatcaggcaggatagccgtgtattacgtaaagtgtttaaattctgcacgacgaat
tcaggaattgatacaggtatacccaatggtttcctggacttttctgaagaagagaaaata
aaaaatatagtatttaacgaggcaaatatcgtatgccccgaagacgaggataaactgatt
tgcgatacgctgaataccatccggctgatgaaggaaattcagtacacgaatggtgaaaag
gcatgccagcgttttattatcagcaactgccagcaggcatcggatatattacagttgatg
gacctgtttttatggagcggctggaaaaaagaaaacctgagcgttgactttatgccgctg
tttgaaatggtgaacgaccttaaaagcgcggcacaggttatggagactttatatacccat
ccggtttacaaagaacacctggcgcggagaggtaatgtacaaacaataatgctgggtttt
agcgatagtactaaagatggcggctacctgatggccaactggtctatctacaacgctaaa
gttgaattgaccgccatggcaaggaaatacggtattgatctggcattttttgatggcagg
ggaggcccgccagcacgcggcggtggtaaaactcatcgtttttatgcttctatgggcgat
gagatcgccaataagcatatccagttgactatacaggggcaaactgtaagttcgcaatac
ggttcggtagaaacagcgcgctttaatatggaacagctgattaacgcgggagttatttca
gcgctgcagccaaatcctaatgatctgctggatgttaagcataaagcgctcatctcagac
atggcggaagaaagctatcaattgttccttgaacttaggcaacaccctttatttgtggaa
taccttgaaaagttcagcccgctgaaactgctttcgcatatcaatatcagcagccggcca
accaaacggaattcggatgctgcccttaaactggaggatttgcgggccattagttttgta
acctcgtggagccaactcaaacaaagtatacctggtttttatggcgtcggcacggccctc
aataaaatgaaggaagcgggtaactggaatgaggtaaaagatctttataactcatcaggc
ttctttaaaacgatggttgataactgcgtcatgtctatgacgaaatcagatttccgggtc
actgcctacctggagaaagataaaaagtttggcccgttttggaaaatgctgcgtgatgaa
tatgaattaacgaaagcaatgctgcttgaattaacgggtactaccatgctgatgggagaa
tatccggtagagcggcgctccatcgccatccgcgaaaaaattgttttgccattggtgatt
atgcagcactatgcattacactgcctaaacaataacccggatgaagaactggctaaaatt
tataacaagctggtgatccgcacggtttatggtattgtaaatgcggggaggaatttggcg
tag

DBGET integrated database retrieval system