KEGG   Meleagris gallopavo (turkey): 100008573
Entry
100008573         CDS       T01523                                 

Gene name
SLC9A1
Definition
(RefSeq) LOW QUALITY PROTEIN: sodium/hydrogen exchanger 1
  KO
K05742  solute carrier family 9 (sodium/hydrogen exchanger), member 1
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp04260  Cardiac muscle contraction
mgp04261  Adrenergic signaling in cardiomyocytes
mgp04371  Apelin signaling pathway
mgp04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    100008573 (SLC9A1)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100008573 (SLC9A1)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    100008573 (SLC9A1)
   04261 Adrenergic signaling in cardiomyocytes
    100008573 (SLC9A1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mgp01009]
    100008573 (SLC9A1)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mgp02000]
    100008573 (SLC9A1)
Protein phosphatases and associated proteins [BR:mgp01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100008573 (SLC9A1)
Transporters [BR:mgp02000]
 Solute carrier family (SLC)
  SLC9: Na+/H+ exchanger
   100008573 (SLC9A1)
SSDB
Motif
Pfam: Na_H_Exchanger NEXCaM_BD OprF
Other DBs
NCBI-GeneID: 100008573
NCBI-ProteinID: XP_010721591
Ensembl: ENSMGAG00000001425
LinkDB
Position
25
AA seq 735 aa
MGHSKGELRQAAGSQGRGEGWERSLLPTSSVPVANVCSALSSPGFHVMSSVSKVVPESCL
LIVVGLLVGGLIKAVGEKPPILKSDIFFLFLLPPIILDAGYFLPLRQFTENLGTILIFAV
VGTLWNAFFLGGLMYAVCQIGGSGLNHIGLLANLLFGSIISAVDPVAVLAVFEEIHINEL
LHILVFGESLLNDAVTVVLYHLFEEFANFEQVTIIDIILGFLSFFVVSLGGVFVGVIYGL
IAAFTSRFTSNIRVIEPLFVFLYSYMAYLSAELFHLSGIMALIASGVVMRPYVEANISHK
SHTTIKYFLKMWSSVSETLIFIFLGVSTVAGQHYWNWTFVISTLLFCLIARVLGVLVLTW
FINKFRIVKLTPKDQFIIAYGGLRGAIAFSLCYLLDYEHFNMRDMFLTAIITVIFFTVFV
QGMTIRPLVDLLAVKKKQETKRSINEEIHTQFLDHLLTGIEDICGHYGHHHWKDKLNRFN
KKYVKKCLIAGERSKEPQLIAFYHKMEMKQAIELVESXGLGKIPSTISAVSIQNISPKTL
PVERVIPTLSKDKEEEIRKILRSNLQKTRQRLRSYNRHTLVADPYEEAWNQMLLRRQKIR
QADRQNAYLTVPANKIDSPTMSRARIGSDPLAYEPKPDSENLPIITIDPASPQSPESVDL
PNEVPKGCGGLPPSPEEDEEGLVMRPKEPSSPGTDDVFTPGTSDSPSSQRMLRCLSDPGP
RQEPEEGEPFIPKGQ
NT seq 2208 nt   +upstreamnt  +downstreamnt
atggggcacagtaaaggggaactgaggcaagcagcaggttctcaaggccgcggcgagggc
tgggagcggtccctccttcccacatcctccgttcccgtagccaacgtgtgctctgctctc
tcctctccaggcttccacgtgatgtcctcggtgtccaaagtggttcccgagagctgcctg
ctcatcgtggtgggccttctggtcggcgggctcattaaagcggtgggcgaaaagcccccc
atccttaaatcagacatcttcttcctcttccttctccctcccatcattttggacgccggc
tatttcctccccttgcgacagttcacggagaacctgggcaccatcctcatcttcgccgtg
gtggggacgctgtggaatgcctttttcctgggggggctgatgtatgccgtgtgccagatc
ggcggcagcggcctcaaccacatcggcctgctggccaacctgctcttcggcagcatcatc
tcggccgtggacccggtggccgtgctggctgtctttgaggagatccacatcaacgagctg
ctgcacatcctggtctttggggagtccctgctgaacgacgccgtcacggtggtcctctac
cacctttttgaggagtttgccaactttgagcaagtgaccattatcgatatcatccttggc
ttcctcagcttcttcgtggtgtctctgggcggcgtcttcgtgggcgtcatttatgggctg
attgctgccttcacgtcccgcttcacctccaacatccgcgtcatcgagcccctcttcgtc
ttcctctacagctacatggcctacctctctgcggagctcttccacctctccggcatcatg
gcgctcatcgcctccggcgtcgtcatgcggccctacgtggaagccaacatctcccacaag
tcccacaccaccatcaagtatttcctcaagatgtggagcagcgtgagcgagaccctcatc
ttcatcttcctgggtgtctccaccgtggctggccagcactactggaactggaccttcgtc
atcagcacgctgctcttctgcctcatcgcgagggttttgggcgtcctggtcctcacctgg
ttcatcaacaagttccgaatcgtgaagctgacaccaaaggatcagttcatcattgcctac
gggggcctgcggggagccatcgccttctccctctgttacctcctcgactacgagcacttt
aacatgagggacatgttcctcacggccatcatcaccgtcatcttcttcactgtcttcgtg
cagggcatgaccatccggcccctggtggatctgctggccgtgaagaagaagcaggagacg
aagcgctccatcaacgaggagatccacacgcagttcctggatcaccttctgacggggatc
gaggatatctgcggtcactacgggcatcaccactggaaagacaagctgaatcgcttcaac
aagaagtacgtgaagaagtgcctgatagcaggagagcgctccaaggagccgcagctcatt
gctttctatcacaagatggagatgaagcaggcaatcgagctggtggagagtnggggcttg
ggcaagatcccctccaccatctccgctgtctccatccagaacatcagccccaaaaccctc
cctgtggaacgcgtcatcccgaccctgtccaaagacaaggaggaggaaatccggaagatc
ctccgcagcaacctgcagaaaaccaggcagaggctgcgatcctacaaccggcacacgctg
gtggctgacccctacgaggaagcctggaaccaaatgctcctgaggaggcagaaaatccgg
caggctgatcgccagaatgcctacctgacagtgccagctaacaagattgattctcccacc
atgtcccgggctcgcatcggctcagacccactggcctacgaacccaagccggactcggag
aacctccccatcatcaccatcgacccggcctccccgcagtccccggagtcggtggacctg
cccaacgaggtgcccaagggctgcggtggcctgcctccctcccccgaggaggatgaggag
gggttggtgatgcggcccaaggagccttcctcccctggcaccgacgacgtcttcacgccg
gggaccagcgacagccccagcagccagaggatgctgcggtgtctgagcgacccggggccg
cggcaggagccggaggagggggagcccttcatccccaaggggcagtag

DBGET integrated database retrieval system