KEGG   Meleagris gallopavo (turkey): 100303688
Entry
100303688         CDS       T01523                                 

Definition
(RefSeq) interleukin-15 precursor
  KO
K05429  interleukin 2
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp04060  Cytokine-cytokine receptor interaction
mgp04625  C-type lectin receptor signaling pathway
mgp04672  Intestinal immune network for IgA production
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100303688
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    100303688
   04672 Intestinal immune network for IgA production
    100303688
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mgp04052]
    100303688
   00536 Glycosaminoglycan binding proteins [BR:mgp00536]
    100303688
Cytokines and growth factors [BR:mgp04052]
 Cytokines
  Interleukins
   100303688
Glycosaminoglycan binding proteins [BR:mgp00536]
 Heparan sulfate / Haparin
  Cytokines
   100303688
SSDB
Motif
Pfam: IL15 Trep_dent_lipo Ntox1
Other DBs
NCBI-GeneID: 100303688
NCBI-ProteinID: NP_001290111
Ensembl: ENSMGAG00000010577
UniProt: Q9PT81
LinkDB
Position
4
AA seq 143 aa
MMCKVLIFSCISVALLMTTAYGASLSPEKLEILPALIKDLEILEESKNKIHVVLYTPNEI
KECSQQTLQCYLEEMVMLKKEIEDEPEIKNEFKNALQNIKKNLHRLKDLSPTGGECKICE
ANDKKNFPDFLQQLTNFVRYLQK
NT seq 432 nt   +upstreamnt  +downstreamnt
atgatgtgcaaagtactgatcttcagctgtatttcagtagcactgcttatgactactgct
tatggagcatcgctatcaccagaaaaattggaaattcttccagcattaataaaagattta
gaaatactggaagaaagcaagaacaagattcatgttgtgctctacacaccaaatgagatc
aaggagtgcagtcagcaaactctgcagtgttatctggaagaaatggttatgctgaagaaa
gaaattgaagatgagcctgaaattaaaaatgaatttaaaaatgctcttcaaaatatcaaa
aagaacctccacagacttaaggatctaagtcccacaggaggtgaatgcaagatctgtgaa
gctaacgacaagaaaaattttcctgattttctccaacaactgaccaactttgtgagatat
ctgcaaaaataa

DBGET integrated database retrieval system