KEGG   Meleagris gallopavo (turkey): 100538760Help
Entry
100538760         CDS       T01523                                 

Gene name
MAP3K14
Definition
(RefSeq) mitogen-activated protein kinase kinase kinase 14
  KO
K04466  mitogen-activated protein kinase kinase kinase 14 [EC:2.7.11.25]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp04010  MAPK signaling pathway
mgp04210  Apoptosis
mgp04625  C-type lectin receptor signaling pathway
mgp04672  Intestinal immune network for IgA production
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100538760 (MAP3K14)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100538760 (MAP3K14)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    100538760 (MAP3K14)
   04672 Intestinal immune network for IgA production
    100538760 (MAP3K14)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mgp01001]
    100538760 (MAP3K14)
Enzymes [BR:mgp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     100538760 (MAP3K14)
Protein kinases [BR:mgp01001]
 Serine/threonine kinases: STE group
  Other
   100538760 (MAP3K14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Pkinase_fungal
Motif
Other DBs
NCBI-GeneID: 100538760
NCBI-ProteinID: XP_010722763
Ensembl: ENSMGAG00000010881
LinkDB All DBs
Position
29
AA seq 941 aa AA seqDB search
MAVMGIACHGAPAPPAKQQQELSATKGLHEAASEKQNSVCKVEDPKKAIFHSQWKILNDV
ITKGTAKEETEGGCASISIIAQAECENSQEFSPTLSERSFIAHSKRYSRSDSLDQIPNNV
AHATEGRMAPTCWRGRHRGKAKKKRHKKRSKLKMQTVAAGRRGPRTPEQESCTPIPVQED
ETHHSALYRNSFWLSELNKSLLYDPPPFEKPEKVLSAGKLHSVGSQHKTDLHKLISPVQC
LNHVWKLHYQRDNVPHPETLRPFPYNIVPPPFPHLDNPIHPMKLNALETYFHRDLNYPDS
EHRLSGLKLGYSFPKCVSQSVKSSLDKVSVEEYLVDALKGSVSLGEPQNLASLAKTWRGG
SLDPKEQFQKADENEGVLLTEKLKPVDYEYREEVHWTKCHGSLGIGSFGEVYKVEDKQTG
FQCAAKKVQVEHFRAEELTTCAAITSPKVVPLYGAVKEGPWVTIFMKLMEGGSLGQLIKQ
SGCLPEDRALSYLGQALEGLEYLHAQNILHGDVKAENVLLSDDGSRALLCDFGHSAHLHP
DGLGKCLVTGNYVPGTETHMAPEVVLGKRCDSKVDVWSSCCMMLHMLNGCHPWTQYYNHP
LCLKIAKEPPPLREIPPSCNPLTAEIIKMGLEKEPVQRASASELRTKASTALREVGGVTS
PWKGEYREPRRLALHKENNPQTSLPPAVSPTSATPDPEPAARGCCASPAPPPALERARQA
EGTRWNESRDLSRTWDPPPLSSTPLPLKSCSHTERATTISEQELQQLEIELFLNSLSQPY
SLEEQEQMLSCLSIDSPFVSDASEKNSMKASLSLRDTMSSGIHSWNSQTDGQSFSWNNVL
SRGRHTDTPSCFNGVKIQIQLLSGENLHIRDFHRTKVGDIATGISSQIPVPAFSLVTKEG
HPIHYDMEVPDSGIELQCTLAPDCSVSWAWRVKHGQLENRP
NT seq 2826 nt NT seq  +upstreamnt  +downstreamnt
atggcagtgatggggattgcgtgccatggagctcccgctccgcccgccaagcagcagcag
gagctcagtgccaccaaagggctgcacgaggccgcgagcgagaagcaaaacagcgtctgc
aaagtcgaggacccaaagaaagccatcttccatagtcagtggaaaatcctcaacgacgtc
atcaccaaaggaacagcaaaagaagaaacagaaggaggctgcgcgtccatctccattatt
gcccaagcagagtgtgagaacagtcaggagttcagccccactttgtcagagagatccttc
attgcccacagcaaacgttacagccgctcagacagcctcgatcagatcccaaacaatgtg
gctcatgcgacggaggggaggatggctcccacctgctggagggggaggcatcgtggtaag
gcgaagaagaagcgtcacaagaaacgatccaagctgaaaatgcaaacagtggctgctggc
agacggggccccagaactccagaacaggaaagctgcactccgattcccgtccaggaggat
gaaacgcaccacagtgctctctacagaaacagcttttggttatcagaactgaacaagagc
ttgctttatgatccacccccgtttgagaaacccgagaaagttctgtctgcgggcaagctc
cattcagtgggcagccagcacaaaactgacttgcacaagctgataagccctgtccagtgc
cttaatcatgtctggaaactgcactaccagagggacaacgtccctcaccctgaaactctc
cgcccttttccatacaacatcgtgccccctcccttcccacacctggacaatcctatccat
cccatgaagcttaatgctctggagacgtatttccatcgtgatctcaattacccagacagt
gagcatcgcttgtctggcctaaagttgggatacagcttccccaagtgcgtcagccagtcc
gtgaaaagcagcttggacaaggtttctgtggaagaatacttggtggacgccttgaagggc
agcgtgagcctcggggagccgcagaacctggccagcctcgccaagacgtggaggggaggc
agtctggacccgaaggaacagtttcaaaaggcagatgagaatgaaggcgtgctgctcact
gagaaactaaagccagtggattatgagtaccgagaagaggttcactggaccaagtgccac
ggctctctgggcatcggctcttttggagaagtgtacaaagtagaggacaagcagacagga
tttcagtgtgctgccaaaaaggtgcaggtcgaacacttccgtgcagaggagttaacgacg
tgcgcggcgataacgagccctaaagttgtgccgctgtacggcgccgtgaaggaggggcct
tgggtgaccatcttcatgaagctgatggagggtggatcactgggtcagctaattaagcag
agcggctgcctgcccgaggacagagccctcagttacctggggcaggcgctggaaggtctg
gagtacctccacgctcagaacattctccatggagatgtgaaagcggaaaacgtgcttttg
tctgatgatgggagcagagctctgctgtgtgattttggtcactctgctcacctccatccc
gacggcttggggaagtgcttggtcacagggaactacgtgcctggcacagagacacacatg
gctccagaggtggtcctggggaagcgctgcgactccaaggtggacgtgtggagcagctgc
tgcatgatgctgcacatgctgaacgggtgccacccctggacgcagtattacaaccatccc
ctttgtctgaagatcgcgaaggagccgccgcctctgagggaaattccaccttcctgcaac
cccctcactgctgagatcattaaaatgggtctggagaaggagccggtgcagagggcgtct
gcgtctgagctgaggaccaaggccagcactgcgctgcgagaagtgggaggtgtgacaagc
ccctggaaaggcgaatacagggagcccaggcgtttggcgctgcacaaagagaacaacccc
cagacatccctgccccccgcagtgagccccacttcggccactcctgacccggaaccggca
gcccgaggctgctgtgccagccctgcgccaccaccggccctggagcgagcgaggcaggcc
gagggaacccgctggaatgagagcagggatctgtccaggacctgggatcctcctcctctc
tcctccactcccctccccttgaagagctgcagccatacagagagagcaaccaccatttct
gaacaagagctccagcagctggaaatagagctgtttctgaacagcctttctcagccgtac
tcactggaagagcaggaacaaatgctttcgtgtctcagcattgacagcccgtttgtgtca
gacgccagtgagaagaactccatgaaggcttccctcagcctgcgggacaccatgagctcc
ggcatccattcctggaacagccagacagacggacagagcttcagctggaacaacgtgctg
agccgcggccgccacacggacacccccagctgcttcaatggagtgaaaatccagatccag
ttgctaagtggagaaaatttacacatcagggatttccacaggacaaaggtgggagacatt
gccactgggataagcagccagatacccgtccccgccttcagcctggtgacgaaggaaggc
caccccattcactacgacatggaagtccccgactcagggattgagctgcagtgcaccctg
gccccggattgcagcgtcagctgggcgtggagagtcaaacacggtcagctggagaacagg
ccgtga

DBGET integrated database retrieval system