KEGG   Meleagris gallopavo (turkey): 100538951
Entry
100538951         CDS       T01523                                 

Gene name
SHISA5
Definition
(RefSeq) protein shisa-5
  KO
K10135  scotin
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    100538951 (SHISA5)
SSDB
Motif
Pfam: Shisa FAM163 Comm EphA2_TM
Other DBs
NCBI-GeneID: 100538951
NCBI-ProteinID: XP_010716688
LinkDB
Position
14
AA seq 139 aa
MGFGTLVAIGVIVFAVIVITIILCLTCSCCCLYKACRRPQPTVTTTTATTVVHAPYPQPQ
GVPPSYPTAPYQGYQPVAIQPQPGMPVASYPAQYPPPYPMQPPGPPAYHETVAAGAGAPY
PISQPPYNPAYVDPQKPTY
NT seq 420 nt   +upstreamnt  +downstreamnt
atgggttttggaacccttgttgcgattggagtgatcgtgtttgcagtgattgtcattact
ataattctgtgcctcacttgctcgtgttgctgtctgtacaaagcatgtcgaagaccgcag
cctactgtgaccaccacgaccgctacaacagtggttcatgccccgtacccacagccgcag
ggagtgccacccagctaccccacagctccgtaccagggataccagcccgtggccatccag
ccacagccggggatgccagtcgcatcctaccctgctcagtatcctcccccctatcccatg
cagccaccgggacccccagcctaccatgaaacagtggcagctggtgctggagcaccgtac
cccatcagccagcccccatacaaccctgcgtacgtggatcctcagaagcccacctactga

DBGET integrated database retrieval system