KEGG   Meleagris gallopavo (turkey): 100539044
Entry
100539044         CDS       T01523                                 

Gene name
CDK6
Definition
(RefSeq) cyclin-dependent kinase 6
  KO
K02091  cyclin-dependent kinase 6 [EC:2.7.11.22]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp04110  Cell cycle
mgp04115  p53 signaling pathway
mgp04218  Cellular senescence
mgp05164  Influenza A
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100539044 (CDK6)
   04115 p53 signaling pathway
    100539044 (CDK6)
   04218 Cellular senescence
    100539044 (CDK6)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    100539044 (CDK6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mgp01001]
    100539044 (CDK6)
Enzymes [BR:mgp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     100539044 (CDK6)
Protein kinases [BR:mgp01001]
 Serine/threonine kinases: CMGC group
  CDK family
   100539044 (CDK6)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Kinase-like Kdo
Other DBs
NCBI-GeneID: 100539044
NCBI-ProteinID: XP_031409750
Ensembl: ENSMGAG00000008824
LinkDB
Position
6
AA seq 204 aa
MMLQLFRGLDFLHSHRVVHRDLKPQNILVTSSGQIKLADFGLARIYSFQMALTSVVVTLW
YRAPEVLLQSSYATPVDLWSVGCIFAEMFRRKPLFRGNSDVDQLGKIFDVIGLPEEEDWP
NDVALPRNAFASRPAQPIEKFVPDIDEMGKDLLLKCLAFNPAKRISAYAALSHPYFHGLE
KCKENLDSHMSSSQNSSEVNASQC
NT seq 615 nt   +upstreamnt  +downstreamnt
atgatgcttcagctgtttcggggactggattttctgcactcacatcgtgtggtgcatcgg
gacctgaaaccccaaaatatccttgtaaccagcagtgggcagatcaagttagctgacttt
ggccttgcacgaatctacagttttcagatggctcttacatcagtggttgttactttgtgg
tatagagctcctgaagttttgcttcagtccagctatgcaacaccagttgatctttggagt
gttggttgcatatttgcagaaatgttccgtcgaaaaccactcttccgtggaaattcagat
gttgatcagctaggaaaaatctttgatgtaattggactcccagaagaagaggactggcct
aacgatgttgcccttccaagaaatgcttttgcttccagacctgcacaacctattgaaaaa
tttgtaccagatattgatgaaatgggcaaagacttgcttcttaaatgcttagcgttcaat
ccagccaagagaatatctgcctatgctgccctgtctcacccatatttccatggtctggag
aaatgcaaggagaatctggactctcacatgtcatccagccaaaactccagtgaggtgaat
gcatcacagtgctga

DBGET integrated database retrieval system