KEGG   Meleagris gallopavo (turkey): 100539102Help
Entry
100539102         CDS       T01523                                 

Gene name
SORD
Definition
(RefSeq) sorbitol dehydrogenase
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp00040  Pentose and glucuronate interconversions
mgp00051  Fructose and mannose metabolism
mgp01100  Metabolic pathways
Module
mgp_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    100539102 (SORD)
   00051 Fructose and mannose metabolism
    100539102 (SORD)
Enzymes [BR:mgp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     100539102 (SORD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C AlaDh_PNT_C ADH_zinc_N_2 DUF281
Motif
Other DBs
NCBI-GeneID: 100539102
NCBI-ProteinID: XP_019474802
Ensembl: ENSMGAG00000001088
LinkDB All DBs
Position
12
AA seq 388 aa AA seqDB search
MGPSWLGATQDSHQLEQPPIFCHFEVNCQEQGIHHISGQQAPESLLSFSVCPQEDRPIPE
PGPNEVLLRMHSVGICGSDVHYWQHGRIGDFVVKDPMVLGHEASGTVIKVGAGVTHLKPG
DRVAIEPGVPRETDDFCKTGRYNLSPTIFFCATPPDDGNLCRYYKHSASYCYKLPDNITF
EEGALIEPLSVGIHACRRAGVTLGSKVFVSGSGPIGLVNVIIAKVMGAAAVIVTDLSASR
LQTAKEVGADFTIQVKNETPQELAAKVESLLGCMPEITVECTGVQACIQASIYATRSGGT
LVLVGLGPEMVTVPIVNAAVREVDIRGIFRYCNTWPVAISLLASKQINIKPLVTHRFPLE
KALEAFEITKRGEGVKVMLKCDPTDQNP
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atggggccgagctggctgggagccacacaggactcacaccagttagagcagcctcccatt
ttctgccactttgaggtaaactgccaggaacagggcatccaccacatctctgggcaacaa
gcacctgagtctctcttgtctttttctgtttgtccacaggaagaccgtccgatcccagaa
ccgggtcccaatgaggtcctcctgcggatgcattctgttgggatctgtggttctgacgtt
cactactggcagcatggtcgaattggagattttgtcgtgaaggaccccatggtgttgggg
cacgaagcttccggaactgtcatcaaagtgggagcgggagtgacacatctgaaaccaggt
gatcgtgtggccatcgagcctggtgtcccaagagaaacagatgacttctgcaaaactggc
cgctacaacctgtctccaaccatcttcttctgtgcaacacctcctgacgatgggaacctg
tgccgctactacaagcacagtgccagctactgctacaagcttccagataacatcaccttt
gaagaaggggcccttattgagccactttcagtgggaatccacgcctgcagaagagcagga
gtcactctgggaagcaaagtctttgtaagtggctcaggaccaattggccttgtgaatgtg
attatagccaaggtgatgggtgcagcagcagtgatagttacagatttatctgcctctcgc
ctgcagactgccaaggaggtgggggcagatttcaccattcaggtaaagaatgagacccca
caggagctggctgccaaagtggaaagtctgcttggctgcatgcctgagataactgtggag
tgcaccggagtccaagcctgcatccaggccagcatttatgccactcgttctggagggacc
ctggtgctggtggggctgggccctgagatggtgaccgtgcccattgtgaacgctgcggtg
cgggaggtggatatccgggggatattccgctactgcaacacgtggcctgtggccatttcc
ttgcttgcatccaagcagatcaacatcaagcccttggttacacaccgcttccccctggaa
aaggctcttgaggcatttgagatcacaaagaggggcgaaggggtaaaagtcatgctgaaa
tgtgaccccactgaccagaacccctga

DBGET integrated database retrieval system