KEGG   Meleagris gallopavo (turkey): 100539457Help
Entry
100539457         CDS       T01523                                 

Gene name
SETD2
Definition
(RefSeq) SET domain containing 2
  KO
K11423  histone-lysine N-methyltransferase SETD2 [EC:2.1.1.43]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    100539457 (SETD2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mgp03036]
    100539457 (SETD2)
Enzymes [BR:mgp01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     100539457 (SETD2)
Chromosome and associated proteins [BR:mgp03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     100539457 (SETD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SRI SET WW
Motif
Other DBs
NCBI-GeneID: 100539457
NCBI-ProteinID: XP_010710605
LinkDB All DBs
Position
6
AA seq 2555 aa AA seqDB search
MFSRLDCNREEENESKTETVQKAGFIKGPVFKGVASSRFLPKGTKTKVNLEEQGRQKVSF
SFSLTKKTLPNRFLAGLGNEKQNETQNSPAVPLQTDFNPKIKMDLGDATGSAEESSPPKP
KVELGKIHFKKHLLSVTTKPLPPAAAATLLPPPPALAPVTEPVAAAADFPSAPPPPPTAS
PAAPMPVPAAAALPQLPVTLMSTLLLSPPAEAEVPASKELCHAVTKEAPELDLKQEVVSH
GLEEHVTQHVAEQVEVTPQKEDSHIGKDDEVSESSKGASLCSRKQGSKRKFSQSDGTLLG
SESDEDSVRTSSSQRSHEQKISSAEKERDPRKSSSSLRGEELKSSSRSRSDRDEKYSSYS
KSERDSRYASSRSRSDRERRRSRSHSRSRSDRSSRTSSSYSRSERSHYYESDRRYHRSSP
YRERTRYSRSYADSRGRESSDSEDEYRRTHSRSSDSRRTSSHSSSYRESRTSYSKSDRDS
KVESSHADMERRGKSSSKADRDSKRTSESEVTKRCSPLNELGYRKGTSHSKPDSNVNSSR
YKSTPSKTPAPKPDKFKSSFCCTESVEEIKQQSNSLDLETSCLKSNEIRVSIAKRFEREK
TLSPLNQLNDSPAFKNTDESKAAFPHSGSEELAGNECRDSVKEQETLVRVKHEQLRTCFP
IEMNINGSPEGSSDDLAAPSASKAEDVAVSSDDSLCRLEASHIGRTSNSYPLPSNGFEST
YIPKEHEPDDSHIQSSECSSLFREEEALVLEQQSEAMPSPVVNVDHSKIAVKKLDDQAAP
CDKTKEPVFCYVSDDAAPSLHHSEVEIEVEPADVKVTSEAFLDLHVEPQTVTCDYESTED
PNSKSACEEEQYHINPPHQAGLAVDSSSRDSAQDCCSPGIRQDCPVVTQHLEENIPSEGD
RAPPSCSGTGEVLELDARHVDLNSTQSLKDEHSYYSQVPLERCSREEAVEEMAVTTERVG
PDDLKEQSQGTSAEDDGGNEPLVASAFPDASFPSCDVVVAAEEPEAVTQTPTCDSSGGTS
EFAPAPHDDYSDTAESDSEPGSDDSETEDSDSDDGVPRKRLQSVVVVPKNSSIAMEDSSP
CSSRSSQGTRHYSDHWDDERPEPSRPYYEERPEATASNNGPQAESRCSPRGMDKSPASST
ELSRKDGEEPRADVCQPQSDGVDSTSQADLAVDSQGKPNPDERTLNELMSISRPLGRQEE
QPFCVPESFEGTDESCHQMSFSKPDSWQGSGGLHQSGLGDCSREDGFHPREGMGGVSWEL
QAEKPSSTYQQPDSSFGVYSGYVYQPGTGAYSSSQNCWQGNGYWDVRSAGRPAGGSYERV
QGQVPDSLTEDHEEYEDDRWDDECKAGFPSPSSKFHTPEQKETGSVQAHEISSNSSKEPV
SGAEKKEEVKSLEKNDVKERGPPKKRRQELESDSESDVDSRERKKVKVEGEQEVAPQDSS
MVGRPCIMDDFRDPQRWKEFAKQGKMPCYFDLIEENVYLTERKKSKSHRDIKRMLCECPP
LSKEERAQGEVACGEDCLNRLLMIECSSRCPNGDFCSNRRFQKKQHADVEVILTEKKGWG
LRAAKDLPSNTFVLEYCGEVLDHKEFKARVKEYARNKNIHYYFMALKNDEIIDATQKGNC
SRFMNHSCEPNCETQKWTVNGQLRVGFFTTKLVPSGSELTFDYQFQRYGKEAQKCFCGSA
NCRGYLGGENRVSIRAAGGKMKKERSRKKDSVDGELEALLENGEGLSDKNQVLSLSRLMV
RIETLEQKLTCLKLIQNTHSQSCLKSFLECHGLSLLWIWMTELGDSRGSTANNLKLQLEI
MKTLELLPIPTKNMLEESKVLPIIQRWAQTKSAIPQLSEGDGYSSENTSRAHTPLNTPEL
SAKQSAEGDTDTPKKLVFRRLKIISENSMDSAISDTTSELEGKEGKEDLDQLEVPPTEVS
EEQQPQQEVKTATDPPVESSKPQELEAEPEAEVKESNGTKLEEPITMETPSQDEEEGVSD
VESERSQEQTDKIVDVSDLATRLLDSWKDLKEVYRIPKKSQAEKESSADRGREAAGLRDQ
TPTPKNPVLSRTDPEWQSLSKEKKRRRDSLSPPASAYERGTKRPEDRYDTPASSKKKVRL
KDRNKLSTEERRKLFEQEVAQREAQKQQQQLQNLGITSPLPYDSMGYGTPHHSFIGYPPG
YPMQAYVDPSNPNAGKVLLPTPSMDSMCSPAAYEHPQPMVGHTVEPTLPTPQPVPVVQHV
ATPMEVTTPQYVAQNDAVVHQEPNVAVLPVPTTGPVQGQSYGVWDSSQQPVAVQQQYSPA
QSQPAIYYQGQTCQTVYGVTSPYSQTTPPIVQSYAQPGLQYIQGQQIYTAHPQGVIVQPP
PAVTTIVAAGQPQPIQQPELVVTNNLLDLPPPSPPKPKTIVLPPNWKTARDPEGKIYYYH
VVTRQTQWDPPTWDSPGDDASLEHEAEMDLGTPTYDENPMKSSKKPKTAEADTSSELAKK
SKEVFRKEMSQFIVQCLNPYRKPDCKVGRITTTEDFKHLARKLTHGVMNKELKYCKNPED
LECNENVKHKTKEYIKKYMQKFGAIYKPKEDTDLE
NT seq 7668 nt NT seq  +upstreamnt  +downstreamnt
atgttttctcggctggattgcaatagagaagaagaaaatgagagcaagactgaaacggtg
cagaaagctggctttatcaaaggcccagtgttcaaaggtgttgcttctagtcgttttttg
cccaaaggcaccaaaacgaaggttaaccttgaagagcaaggaagacaaaaggtgtctttc
agctttagcttaaccaagaaaaccttaccgaacagatttctggccggtctgggaaacgaa
aaacaaaatgaaactcagaactccccagcagtacccctacagactgattttaaccccaaa
attaaaatggaccttggggatgctactggttcagcggaggagtcttcacctccaaaaccg
aaggtagaactggggaaaatccattttaagaaacatttacttagtgtcacaactaaaccc
ctcccaccagctgcagcagcaactttactgccgccgccaccggctctggcaccggtaaca
gaaccagtggcagcggccgcggactttccatcagcaccaccacctccaccaacagcatca
ccagcagcaccaatgcctgtccccgctgcagcagccttgccacagctgcccgtcacgctc
atgtcaacgctgttgctgtcaccgcctgcagaagcagaagtcccggcttcgaaggagctg
tgccacgcggtcactaaggaggctcctgagctggaccttaagcaggaggtggtatcgcac
ggtttggaagaacacgtaactcaacacgtggccgagcaggtggaagtaactccacagaag
gaagattcccatattgggaaagatgatgaggtttcagaaagctccaagggtgcttctttg
tgctctaggaaacagggctccaaaaggaagttctcccagtccgatggcacgttgctgggc
tctgagtctgatgaagattccgtgaggacttcttccagccagcgctcacatgagcagaag
atatccagtgcagaaaaggagagggatcccaggaaaagctcttcctctctcagaggagaa
gaactgaaatcctcctcacgctccagatcggatagagatgaaaagtattctagctattca
aaatcggaacgagattcgcggtatgcatcctcccgatcccggtcagacagagaaagaagg
cgaagccggtcccattctcggtcccggtcggatcggagctcccgaaccagctcttcctac
tcgaggtcggagcgctcacattactacgaatcagaccgcaggtatcaccggagctccccg
tacagagagaggacaagatactcccgctcgtacgcagactccagggggagggagagttct
gattcggaagatgagtacagaaggacgcattccagatccagtgactcgaggcggacgtcg
tcccactcctcctcgtacagagagtcaaggacttcttactctaagtcagacagggacagc
aaagtagagtcatctcatgctgacatggagaggagaggaaagtcttcttcaaaagctgat
agagattcaaaacggacttcagaaagtgaagtaaccaaaaggtgctctccccttaacgag
ctcgggtatcgaaaggggacttcccattctaagcctgacagtaatgtgaattcttcccgt
tataagtccaccccttcaaagacccctgcaccaaagcctgataaatttaaaagttctttc
tgttgtacagaatcagttgaagaaataaaacagcagtctaattctctagatttagagacc
tcttgtttaaaaagcaatgagatcagagtgtccattgcaaaaagatttgaaagggaaaag
acgctttctccattaaatcagttaaatgattcccccgcttttaaaaacacagatgaatca
aaagctgcttttcctcactcagggtctgaggaacttgcaggcaatgaatgccgtgacagt
gttaaggaacaagagactttagtaagggtaaagcacgagcaattgagaacatgtttccct
atagaaatgaatataaatgggtccccagagggtagctctgatgatctggcagctcccagt
gcctccaaagcagaggatgtcgcagtatcttctgatgatagtttgtgtaggttggaagca
tcacacattggaaggacgagtaactcgtatccactgccctcgaatggatttgagagcacg
tacatccctaaagagcacgagcccgacgattctcacatacagtccagcgagtgtagcagc
ctgttcagggaggaagaggctctggtcctggagcagcaaagtgaagctatgccttcacca
gttgtgaatgtagaccattccaaaattgcagtgaagaagctggatgatcaggcagctccc
tgtgacaaaaccaaagaaccagttttttgctacgtttcagatgatgccgctccttctttg
catcattcagaagttgaaatcgaagttgaaccagcagatgtgaaagtgacttccgaggca
tttctggacttgcacgttgaaccgcagacggtgacgtgcgactatgaaagcacagaggat
ccgaattcaaagtctgcatgtgaagaggagcagtatcacattaacccaccccatcaagct
ggcctagctgtggatagttcaagcagggattctgcccaggactgctgttcacctggaatc
aggcaggactgtcctgtggttactcagcatctggaggaaaatattccctccgagggggac
agggccccgccgagctgctcgggcactggggaggtgctcgagttggatgctcggcacgtt
gacctgaactcaacacagtcactcaaggatgagcattcctattattcccaagtgccactg
gaacgctgtagcagagaggaggcagtggaagaaatggccgttactacggagagagttggt
cctgatgatctgaaagagcaaagccagggaacgtctgccgaggatgacggagggaatgag
cccttggtggcttcagcttttccagacgcttcgtttccatcttgtgatgttgtggtggct
gcggaagaaccagaagccgtaacgcaaaccccaacgtgtgacagcagtggtggtacctcc
gaattcgctcccgctccccatgatgactattctgacacggctgaaagcgacagcgagccg
ggcagcgacgacagtgagacagaggattctgattcggatgatggcgtgccacggaagcgg
ctgcagtccgttgtggttgtcccgaagaactcgagcattgcgatggaggacagcagcccc
tgctcctcgcggagcagccagggcacgcggcattactctgaccattgggatgacgagagg
ccagaaccaagcaggccctactatgaggagaggccagaggctacggcgagtaacaacggg
ccccaggctgagagcaggtgctctccgagagggatggacaagagtccggcctcgtctact
gagctcagcaggaaagatggcgaagagccgcgggcagacgtctgccagccgcagagcgat
ggcgtggacagcacgagccaggcagacctggcggtggattctcaaggcaaacccaaccca
gatgagaggacgcttaatgagctgatgtccatcagtaggccgcttggccggcaggaggag
cagccattttgtgtgcctgagagctttgagggcaccgatgagtcttgccatcagatgagc
ttttctaagccagacagctggcaggggagtgggggtctccatcagtctggccttggagac
tgctccagggaggacggttttcatccacgggagggtatgggtggcgtgagctgggagttg
caggcagagaagcccagcagcacctatcagcagccagatagcagcttcggggtctattcg
ggctacgtgtaccagccaggcacaggagcctacagcagttctcagaactgctggcagggc
aatggctactgggatgtgaggtctgctggccggcctgctggaggcagctatgaacgagtt
caaggacaagtgccggattctctaacggaggatcacgaggagtacgaggatgaccgctgg
gatgatgagtgcaaggctggcttccccagcccctccagtaagttccacactcccgagcag
aaagagacaggctccgtgcaagcccatgagatcagcagcaactcgagcaaggagccggtg
tctggtgctgagaaaaaagaggaggtgaagtctttggaaaagaacgatgtgaaggagcga
ggccctcccaaaaaacgacggcaggagctggagagtgactccgagagcgatgtggactcg
agggagagaaaaaaggtgaaggtggagggtgagcaggaggtggcaccgcaggactcctcc
atggtcggccgcccgtgcatcatggacgacttccgcgacccgcagcgctggaaggagttt
gccaagcaggggaaaatgccctgttacttcgacctcattgaggaaaatgtgtacttgaca
gaaagaaagaagagcaaatcccaccgggatattaagcgaatgctgtgtgaatgccctcct
ctctccaaggaagaacgagctcagggggaggttgcttgtggagaagactgcctgaaccgc
ctgctcatgatcgagtgttcttccaggtgcccaaatggtgacttctgttccaaccgacgc
ttccagaagaagcagcacgcagatgttgaagtaatccttactgagaagaaaggttgggga
ctcagagctgccaaagatctcccatcaaacacttttgtgttggaatactgcggagaggtg
ctggaccacaaagagttcaaggcacgtgtgaaggaatatgcccgcaacaagaacatccac
tactacttcatggctttgaagaatgacgagataatagatgctacccagaaaggaaactgc
tctcgttttatgaaccacagctgtgaaccaaactgtgagacacaaaagtggactgtgaat
gggcagctcagagttgggttcttcaccaccaagctggtcccgtcaggctccgagctgacc
tttgattaccagttccagagatacggcaaagaagctcagaaatgtttctgtggctcagcc
aactgccggggctacctgggaggagagaacagggtcagcatccgggctgcaggggggaag
atgaagaaggaacgctcccgtaagaaggattcggtggatggggagctggaggcactgctg
gagaacggggagggcctctcagacaagaaccaagttctcagcttgtcccggctgatggtg
cgcatcgagaccctggagcagaagctcacctgcctcaagctcatccagaacacgcactca
cagtcctgcctgaagtccttcctggagtgccacggcttgtcactgctgtggatctggatg
acagagctgggtgacagcaggggaagcactgccaacaacctcaagctgcaactggagatt
atgaagacgctggagctgctgcccatccccaccaaaaacatgctggaggagagcaaggtg
cttcccatcatccaacgctgggctcagaccaagagtgccatcccacagctcagtgaaggt
gatggatactcgagtgagaacacgtcgcgcgctcacacaccgctcaacacgccggagctg
tctgccaagcagagtgctgagggggacacggatacccccaagaaactggtattccggagg
ctcaaaattataagtgagaacagcatggacagtgccatctcggatacaactagtgagctg
gaggggaaggaaggcaaagaggacctggaccagctggaggttcccccgacggaggtgtca
gaagagcagcagccacagcaggaggtgaaaacagccacggatccaccggtggagagcagc
aagcctcaggagctggaggctgagcctgaagcagaggtcaaggagagcaatggcaccaag
ctggaggagcccatcacgatggaaacgccatctcaggacgaagaggaaggcgtatctgat
gtcgagagcgagaggagccaagagcaaacagacaaaattgtggatgtgagcgacttggcc
accaggctgctcgacagctggaaagacctgaaggaggtgtaccgaatcccaaagaagagt
caagcagaaaaggagagcagtgctgaccgaggcagagaggcagctggcctcagggatcag
actcccacacctaagaaccccgtcctgagccgcacagaccctgagtggcagagcctgagc
aaggagaagaagaggaggcgagactcactgtcccctccagcatcagcgtatgagcgaggc
accaagagacctgaggacaggtatgacacgccagcatcctcgaagaagaaagtccgcctc
aaggaccgcaacaagctgtcgacagaggaacgcaggaagctctttgagcaggaggtggcc
caacgagaggcccaaaagcagcaacaacaactgcagaacttgggcataacgtcccccctt
ccctacgactccatgggctatggcacaccgcaccacagcttcatcggctacccacctggc
taccccatgcaggcctacgtggaccccagcaaccccaatgcgggcaaggtgctgctgccc
accccaagcatggactctatgtgctccccagcagcctacgagcaccctcagcccatggtg
gggcacacagttgaacccaccctgcccactccccagccggtcccagtagtccaacatgta
gcaacgccgatggaggtgacgactcctcagtatgtagcacaaaacgacgccgtggtccac
caagaacccaacgtggctgtcctgcccgtgcccaccacgggaccagtgcaggggcagagc
tacggggtgtgggattccagccagcagccggtggccgtgcagcagcaatactcgccagcc
cagtcccagcctgccatatattaccaaggccagacctgtcagactgtttatggggtgacg
tccccctactcgcagacgaccccaccgattgtacagagctacgcccagccaggcctgcag
tacatccaggggcagcagatctacacagcccacccgcagggagtgattgtccagccccct
cctgctgttaccaccatcgtggccgctgggcagccacagcccatccagcagccagagctt
gtggtgaccaacaacctcctggacctgcctcctccatcccctcccaaacccaaaaccatt
gtcctgcctcccaactggaaaacagccagagaccccgaggggaagatctactactaccac
gtggtaacgaggcaaacccagtgggaccctccaacgtgggacagcccaggggatgatgcc
agcctggaacacgaagctgagatggacctggggaccccaacgtatgatgaaaacccaatg
aagtcttccaaaaagcccaagactgcggaagcagacacgtcgagcgagcttgccaagaag
agcaaggaagtcttcaggaaagagatgtctcagttcatcgtgcagtgcctcaacccctat
cgcaaacccgactgcaaggtcggccggatcaccaccaccgaggacttcaagcacctggca
cggaagctgacgcacggcgtcatgaacaaggagctgaagtactgcaagaacccagaggac
ctggagtgcaacgagaatgtgaaacacaaaacgaaggagtacataaagaaatacatgcag
aaattcggggccatctacaaacccaaagaggacacggacttggagtga

DBGET integrated database retrieval system