KEGG   Meleagris gallopavo (turkey): 100539471
Entry
100539471         CDS       T01523                                 

Gene name
GTF2H3
Definition
(RefSeq) general transcription factor IIH subunit 3
  KO
K03143  transcription initiation factor TFIIH subunit 3
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp03022  Basal transcription factors
mgp03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    100539471 (GTF2H3)
  09124 Replication and repair
   03420 Nucleotide excision repair
    100539471 (GTF2H3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:mgp03021]
    100539471 (GTF2H3)
   03400 DNA repair and recombination proteins [BR:mgp03400]
    100539471 (GTF2H3)
Transcription machinery [BR:mgp03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     100539471 (GTF2H3)
DNA repair and recombination proteins [BR:mgp03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TFIIH complex
     100539471 (GTF2H3)
SSDB
Motif
Pfam: Tfb4 TetR_C_38 DivIVA
Other DBs
NCBI-GeneID: 100539471
NCBI-ProteinID: XP_010718381
Ensembl: ENSMGAG00000003111
LinkDB
Position
17
AA seq 267 aa
MVLGNSHLFMSRTNKLAVIASHTQESRFLYPGKRWASADLLGDGGNSVESNCSGSKDGKY
ELLTAINDAIAEEIKDLMTKTDMMGQQTETLLAGSLAKALCYINKMSKEVKANQEMKSRI
LVIKAAEDSALQYMNFMNVIFAAQKQSILIDACVLDSDSGLLQQACDITGGIYLKVPHLP
SLLQYLLWVFLPDQEQRSQLVLPPPVHVDYRAACFCHRNLIEIGYVCSVCLSIFCNFSPI
CSTCETAFKISLPPVMKAKKKKLKLAV
NT seq 804 nt   +upstreamnt  +downstreamnt
atggtgctgggaaattcacacctgttcatgagtcgcaccaacaaacttgctgtgatagca
agtcacacacaggaaagccgtttcttgtaccctgggaagcgttgggcttctgcagatctc
cttggagatggtggtaattccgtggaatcaaattgttctggcagcaaggatggaaaatat
gaattgttaacagcgataaatgatgcaattgcagaagagattaaagacctcatgacaaaa
actgacatgatgggccagcaaacagagactttactagcagggtctcttgctaaagcactt
tgttacattaacaagatgagcaaagaggtgaaagccaatcaggaaatgaaatcaaggatt
ttggtcataaaagctgcagaagacagtgcattacaatatatgaatttcatgaatgtgatc
tttgcagcacagaaacagagtattttgattgatgcttgtgtcttggactctgattcaggc
cttctacaacaggcttgtgacattacaggcggtatatacttgaaagtgccccatctgcca
tccctcctgcagtatttgttgtgggtatttctccctgatcaagagcaaagatcacagctt
gttcttccacctcctgttcatgttgactacagagctgcatgtttctgtcatcggaatctc
attgaaattggttatgtatgctctgtgtgcttgtcaatattctgcaacttcagtcctatt
tgcagtacatgcgagactgctttcaaaatatcactgccacctgtcatgaaagctaagaag
aagaaattaaagttagctgtttaa

DBGET integrated database retrieval system