KEGG   Meleagris gallopavo (turkey): 100539598
Entry
100539598         CDS       T01523                                 

Gene name
IGFBP3
Definition
(RefSeq) insulin-like growth factor-binding protein 3
  KO
K10138  insulin-like growth factor-binding protein 3
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp04115  p53 signaling pathway
mgp04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    100539598 (IGFBP3)
   04218 Cellular senescence
    100539598 (IGFBP3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mgp04131]
    100539598 (IGFBP3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mgp04147]
    100539598 (IGFBP3)
Membrane trafficking [BR:mgp04131]
 Endocytosis
  Others
   Insulin-like growth factor-binding proteins
    100539598 (IGFBP3)
Exosome [BR:mgp04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   100539598 (IGFBP3)
SSDB
Motif
Pfam: Thyroglobulin_1 DUF4829
Other DBs
NCBI-GeneID: 100539598
NCBI-ProteinID: XP_010706526
LinkDB
Position
3
AA seq 171 aa
DELRAFLAPAPHAAGNSGDSEEDRSTSSLENQAIPNLHRVPDSNLPPQHIRIDIIRKEQA
KNTQRYKVEYDSQSTDTLNFSSESKQETEYGPCRREMEDTLNHLKILNVLSPRGFHIPNC
DKKGFYKKKQCRPSKGRKRGYCWCVDKYGQPLPGYDGKGKGDVHCYNLESK
NT seq 516 nt   +upstreamnt  +downstreamnt
gacgagctgcgggccttcctggcgccggcaccgcacgctgcaggaaattctggtgattca
gaagaagacaggagtaccagtagcttagaaaatcaggccatcccaaacttgcacagagtg
ccagattcaaatttgcctccgcagcacatcagaatagatatcatcaggaaagagcaagcc
aaaaatacgcagcgctataaagtggaatatgattcacagagtacagatacactgaatttc
tcttcagaatccaagcaagaaactgaatatggtccctgtcgtagagaaatggaagacact
ttaaaccacctaaagatcctcaatgtcttgagtcctaggggtttccatattccaaattgt
gacaagaagggattctacaagaaaaagcaatgccgtccatccaaaggccgaaaaagaggt
tattgctggtgtgtggataaatatggacaaccgcttcctggatatgatggcaagggaaaa
ggagatgtccactgctataacttggaaagcaagtga

DBGET integrated database retrieval system