KEGG   Meleagris gallopavo (turkey): 100539605
Entry
100539605         CDS       T01523                                 

Definition
(RefSeq) tumor necrosis factor receptor superfamily member 6-like isoform X1
  KO
K04722  tumor necrosis factor receptor superfamily member 10A/B
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp04060  Cytokine-cytokine receptor interaction
mgp04115  p53 signaling pathway
mgp04210  Apoptosis
mgp04217  Necroptosis
mgp05132  Salmonella infection
mgp05164  Influenza A
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100539605
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100539605
   04217 Necroptosis
    100539605
   04115 p53 signaling pathway
    100539605
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100539605
  09172 Infectious disease: viral
   05164 Influenza A
    100539605
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mgp04050]
    100539605
   04090 CD molecules [BR:mgp04090]
    100539605
Cytokine receptors [BR:mgp04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   100539605
CD molecules [BR:mgp04090]
 Proteins
  100539605
SSDB
Motif
Pfam: TNFR_c6 Death MtN3_slv
Other DBs
NCBI-GeneID: 100539605
NCBI-ProteinID: XP_010709352
LinkDB
Position
5
AA seq 402 aa
MPGSGAEVCGEGEYLYESICCVLCPAGTYVAQHCSIPHSSGRCASCTEGRDYTAHANGLE
ECLLCRECKDDQITSRICTVTSDTECQCKQGYFCPAEGCEICQKCSQMCPEKKEIVRICN
ATMDLECGLPDQGNKYLTWTTVIISVAGFFAGLLVFCAIRKRKSDKAALSDKEERSQTYE
DDTLLSEVKIPENNASPPNSENSGENPEGQAYNSVNLEVENTSPEENSAVRVSYERGTVP
QKNLWYQTQECWKRIKNYSSSTINSCNPAFQPNARCKIRGVKMPAYFMVQKQKCQIIVKD
LTQKEQMDCFSAFINIVPVKKWKKLMRTHLEENVIDKIEYKWPNNIDEQSYQMLLTWKNT
LGEKQTIIKLLDELWDIDTRAYSKIVHILTSNNIISKIETTA
NT seq 1209 nt   +upstreamnt  +downstreamnt
atgcctggaagcggcgcagaggtctgcggagagggagagtacttgtacgaaagcatttgc
tgcgtgctgtgcccggcaggtacttatgttgctcagcactgcagtattccacattcaagt
ggaagatgtgcctcttgcaccgaaggaagagattacactgcccatgcaaatggcttggaa
gaatgcttgctgtgcagagagtgcaaagacgaccagataacttcaagaatctgtactgtg
acaagtgacactgaatgccaatgcaaacagggatacttttgccctgctgaaggctgtgaa
atatgtcagaaatgcagtcaaatgtgtccagaaaagaaagaaattgtgcggatttgcaat
gctacaatggacctagaatgtggcttacctgatcaaggaaataaatatcttacttggacg
actgtaataatttcggttgctggtttttttgctggtttgcttgtgttctgtgcaataagg
aagcgtaagagtgataaagccgctttatctgacaaagaagagaggagccagacatacgaa
gatgatacacttctatcagaagtgaagatacctgaaaataatgcatcccctccaaatagt
gagaactctggtgagaacccagagggtcaagcatacaatagtgttaatttagaagtggaa
aacacatctccagaggaaaacagtgctgtgagagtgtcttatgagagaggcaccgtccca
cagaagaacttgtggtaccaaacacaagaatgttggaagaggatcaaaaactattcatca
tctacaataaatagttgtaatcctgcttttcaaccaaatgcccggtgtaaaataaggggt
gttaagatgccagcatattttatggtacaaaagcaaaagtgtcaaataattgttaaagat
ctcactcaaaaagaacagatggattgcttttctgcttttataaatatagtaccagtgaaa
aaatggaagaagcttatgagaactcatctggaggaaaatgttattgataaaattgagtat
aagtggcctaataacatagacgagcaatcttatcagatgcttctcacctggaaaaacaca
ttgggggagaaacaaactattattaagttattggatgagctatgggatatagataccagg
gcttacagtaaaatagtccacattttaacaagtaataacattataagtaaaatagaaact
acagcttaa

KEGG   Meleagris gallopavo (turkey): 664712
Entry
664712            CDS       T01523                                 

Gene name
TNFRSF10B
Definition
(RefSeq) tumor necrosis factor receptor superfamily, member 10b precursor
  KO
K04722  tumor necrosis factor receptor superfamily member 10A/B
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp04060  Cytokine-cytokine receptor interaction
mgp04115  p53 signaling pathway
mgp04210  Apoptosis
mgp04217  Necroptosis
mgp05132  Salmonella infection
mgp05164  Influenza A
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    664712 (TNFRSF10B)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    664712 (TNFRSF10B)
   04217 Necroptosis
    664712 (TNFRSF10B)
   04115 p53 signaling pathway
    664712 (TNFRSF10B)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    664712 (TNFRSF10B)
  09172 Infectious disease: viral
   05164 Influenza A
    664712 (TNFRSF10B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mgp04050]
    664712 (TNFRSF10B)
   04090 CD molecules [BR:mgp04090]
    664712 (TNFRSF10B)
Cytokine receptors [BR:mgp04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   664712 (TNFRSF10B)
CD molecules [BR:mgp04090]
 Proteins
  664712 (TNFRSF10B)
SSDB
Motif
Pfam: Death TNFR_c6
Other DBs
NCBI-GeneID: 664712
NCBI-ProteinID: NP_001290129
Ensembl: ENSMGAG00000001239
UniProt: O57408
LinkDB
Position
24
AA seq 368 aa
MRSAALRFCPVLLLLLAKVHLGSAAAVKKRAVKSDVLKPDPYSKKCPMGTYLANDSSRCL
PCKKDEYTEYPNDFPKCLGCRTCREDQVEVSPCNSTRNTRCACKNGTFCLPDHPCEMCQK
CQTRCPKGQVRIAACTQQSDLRCGPPLDNSSSFTTTGIIISTVLPVVLVFLLVLLCCCCC
RRYSAGSGGVLSRKPRAMVKILLQRMGIQDNNCNEQIYQQQQQQQQQLLTTEQGSEVPRG
VEVEVEEVAPRTPNVETQRNLVPVPGKDPITVLSSSFNTFVDLVPFPQWRRFGRALGLRE
NNLYQAEQNDRESGEPLYQMLIMWLNKEGSKASVNTLLETLSQISLSGVADIIASELIRN
GYFQYEVS
NT seq 1107 nt   +upstreamnt  +downstreamnt
atgcgctcagctgcgctccggttctgccccgtcctgctgctgctgttggcgaaggttcac
ttgggatctgctgcggcagtgaagaagcgggcagtcaagtcagatgtcctgaagccagac
ccctacagcaagaagtgtcctatgggcacctatttggcaaacgactcctccaggtgcctc
ccatgtaagaaggatgagtacaccgagtatccgaacgacttccccaagtgcctgggctgc
cggacgtgtagggaagaccaggtggaggtgagtccctgcaactccaccaggaacacacgg
tgcgcttgcaagaacggcaccttctgcttacctgaccacccctgtgagatgtgccaaaag
tgccaaacccggtgccccaaaggacaagtgaggatagctgcttgcacgcagcagagcgac
ctgcggtgcggtcctcccttggacaactcctccagcttcaccaccacaggcatcattatc
agcaccgtgctgcctgtggtcctggtgttcctgctggtgttattatgctgctgctgttgc
agacgctacagtgcagggagtggtggagtgctgagcaggaagcccagagccatggtgaaa
atactgttgcagcggatggggattcaggacaacaactgcaatgagcagatctaccagcag
cagcagcagcagcagcagcagctgctcaccacagagcagggctcagaggttccccgtggt
gtggaggtggaggtggaggaggtggcaccaagaactcccaatgtggaaacccagaggaat
ctggttccagtgccaggaaaggaccccataactgttttgtcttcctctttcaacaccttt
gtcgaccttgtgcccttccctcaatggaggagattcggccgagccctcggtctgcgggaa
aacaacctttatcaggcagagcagaacgacagagagtcaggggagcccttatatcagatg
ctcatcatgtggctcaacaaagaaggcagcaaagcttctgtgaatacactgctggagacc
ctgtcccagatcagcctcagcggcgtggcagacataattgcctccgaactcattaggaat
ggatatttccagtatgaagtgagctga

DBGET integrated database retrieval system