KEGG   Meleagris gallopavo (turkey): 100539609
Entry
100539609         CDS       T01523                                 

Gene name
POLE2
Definition
(RefSeq) DNA polymerase epsilon subunit 2
  KO
K02325  DNA polymerase epsilon subunit 2 [EC:2.7.7.7]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp03030  DNA replication
mgp03410  Base excision repair
mgp03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    100539609 (POLE2)
   03410 Base excision repair
    100539609 (POLE2)
   03420 Nucleotide excision repair
    100539609 (POLE2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mgp03032]
    100539609 (POLE2)
   03400 DNA repair and recombination proteins [BR:mgp03400]
    100539609 (POLE2)
Enzymes [BR:mgp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     100539609 (POLE2)
DNA replication proteins [BR:mgp03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   DNA polymerase epsilon complex
    100539609 (POLE2)
DNA repair and recombination proteins [BR:mgp03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase epsilon complex
      100539609 (POLE2)
SSDB
Motif
Pfam: DNA_pol_E_B
Other DBs
NCBI-GeneID: 100539609
NCBI-ProteinID: XP_031409612
Ensembl: ENSMGAG00000013709
LinkDB
Position
5
AA seq 467 aa
MIELPTVEAAVQECSQASDETIENVFNIIGAFDIPRYIYSSERKRFLPLSMTNFPVPNLF
GTARDKAELFRERYSILQQRTHRHELFTPAAVVVHPDDSRSKFQLKTVETLLGNTVKVGE
VIVLGMITQLKEGKYFLEDPTGVVQLDLSQAQFHSGLYTESCFVLAEGWYEDEVFHVNAF
GFPPTEPSATTRAFYGNINFFGGPSSNSVKASAKLKQLEDENEDAMFVFLSDVWLDQAEV
LEKLHTMFSGYSSAPPTCFFFCGNFSSAPYGKNQIQSLKGSLKALADIICEYPSIHKSSR
FVFVPGPEDPGPGSVLPRPPLAENITQEFRQLVPFSVFTTNPCRIQYCTQEIIIFREDLV
NKMCRNCVRFPSSSMDIPNHFVKTILSQGHLTPLPLYVSPVYWAYDYALRVYPVPDMLVI
ADKYDPFTVTNTDCLCINPGSFPRSGFSFKVFYPSNKTVEDSKLQGL
NT seq 1404 nt   +upstreamnt  +downstreamnt
atgatcgaactgcccacggtggaagcagctgtccaagaatgtagccaagcgtcagatgaa
acaatagaaaatgttttcaacattattggagcctttgatattccacgctacatttacagt
tcagaaagaaagagatttctacctctgtcaatgaccaactttcctgtaccaaatttattt
ggaactgccagagataaagcagagttgtttcgtgaacgttactccatcttacaacagagg
actcacagacatgagctgtttacacctgcagcagtcgtcgttcatcctgatgacagtagg
agcaaattccagcttaaaacagtagaaacactgctgggcaatacagtgaaagtgggggaa
gtgattgtccttgggatgataactcagcttaaggaggggaagtatttcctagaagaccct
acaggagttgtccagctagaccttagtcaagcacagttccacagtggtttatataccgaa
tcatgcttcgttttggcagaaggttggtatgaagatgaagtttttcatgtgaatgctttc
ggatttccgcctactgagccgtctgctaccactagagccttctatgggaatataaacttc
tttggaggtccttcctcaaattcagtaaaggcttctgcaaagctgaagcagctggaggat
gaaaatgaggatgccatgtttgtatttctttccgatgtgtggctggaccaagctgaagta
ctagaaaagctgcatacaatgttttcaggttattcctctgctcctccaacctgctttttc
ttttgtggaaatttctcatctgcaccatatggaaaaaaccaaattcagtctctgaaaggt
tccttgaaggctcttgcagatatcatatgtgaatatcccagcattcataaaagtagtcga
tttgtgtttgttcctggccctgaagatcctggtcctggctctgttttaccacgacctcct
ctggctgaaaacatcactcaggaattcaggcagctggtaccattttcagttttcaccaca
aatccttgcaggattcaatattgcacacaagaaataattatcttccgtgaagatttggta
aacaaaatgtgcagaaactgcgtccgcttccctagcagcagcatggacattcccaatcac
tttgtaaagaccatattatcacaaggacacctgacaccacttccactgtatgtcagccct
gtgtactgggcctacgactacgccctgagggtctatcctgtgccagatatgctcgtcatt
gcggataaatacgaccccttcactgtcaccaacactgactgtctttgcataaatcctggt
tcttttccaaggagtgggttttctttcaaggtattctacccctccaacaagacagttgaa
gacagcaagcttcagggtctctga

KEGG   Meleagris gallopavo (turkey): 100546821
Entry
100546821         CDS       T01523                                 

Gene name
POLE
Definition
(RefSeq) DNA polymerase epsilon catalytic subunit A
  KO
K02324  DNA polymerase epsilon subunit 1 [EC:2.7.7.7]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp03030  DNA replication
mgp03410  Base excision repair
mgp03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    100546821 (POLE)
   03410 Base excision repair
    100546821 (POLE)
   03420 Nucleotide excision repair
    100546821 (POLE)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mgp03032]
    100546821 (POLE)
   03400 DNA repair and recombination proteins [BR:mgp03400]
    100546821 (POLE)
Enzymes [BR:mgp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     100546821 (POLE)
DNA replication proteins [BR:mgp03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   DNA polymerase epsilon complex
    100546821 (POLE)
DNA repair and recombination proteins [BR:mgp03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase epsilon complex
      100546821 (POLE)
SSDB
Motif
Pfam: DUF1744 DNA_pol_B_exo1 DNA_pol_B DNA_pol_B_exo2 RNase_H_2 APP_N Na_trans_assoc
Other DBs
NCBI-GeneID: 100546821
NCBI-ProteinID: XP_010718801
Ensembl: ENSMGAG00000009340
LinkDB
Position
17
AA seq 2300 aa
MQKGPRCPPDLHRELTGTLRPPRPSPRSPGEHQRIRRSSDDGPALSALKRLERSQRTDRL
DALFGFERPSEPCERTGWLINMHPTEVLDEDRRAVSAVDYYFIQEDGSRFKVALPYRPYF
YVATQQGCEREVSSFLAKKFQGKIAKLETVPKEDLDLPNHLVGLKRHYLKLSFSTVDELV
KVRKEISPAVRKNRERDHASDVYTSMLSSALAGGSLTTAEEGASKKVTNQMDNIVDMREY
DVPYHVRLSIDLKIHVAHWYNVRYRGSTFPPEITRRDDLVERPDPVVLAFDIETTKLPLK
FPDAETDQIMMISYMIDGQGYLITNREIVSEDIEDFEFTPKPEYEGPFCVFNEPDEAHLI
QRWFEHVQETKPTIIVTYNGDFFDWPFVEARAAAHGINMYQEIGFQKDSQGEYKASQCIH
MDCLRWVKRDSYLPVGSHNLKAAAKAKLGYDPVELDPEEMCRMATEEPQTLATYSVSDAV
ATYYMYMKYVHPFIFALCTIIPMEPDEVLRKGSGTLCEALLMVQAYHANIIFPNKQEQEF
NKLTEDGHVLDSETYVGGHVEALESGVFRSDIPCRFKMNPAAFDYLVQNVEKTLRHAIEE
EEGLPLDQVTNFQEVCDEIKVKLNSLKDVPNRIECPLIYHLDVGAMYPNIILTNRLQPSA
MVDEATCAACDFNKPGANCQRRMTWQWRGEFMPASRSEYHRIQQQLESEKFPPLYPDGAP
RAFHELSREEQAKYEKKRLADYCRKAYKKIHVTKVEERVTTICQRENSFYVDTVRAFRDR
RYEFKGLHKVWKKKLSAAMETGDASEVKRCKNMEILYDSLQLAHKCILNSFYGYVMRKGA
RWYSMEMAGIVCFTGANIITQARELIEQIGRPLELDTDGIWCVLPNSFPENFVIKSTNAK
KPKVTISYPGAMLNILVKEGFTNDQYQELQDPASLTYVTRSENSIFFEVDGPYLAMILPA
SKEEGKKLKKRYAVFNEDGSLAELKGFEVKRRGELQLVKIFQSSVFEAFLKGTTLEEVYA
SVAKVADYWLDVLYSKAANMPDSELFELISENRSMSRKLEDYGEQKSTSISTAKRLAEFL
GDQMVKDAGLSCRFIISKKPEGSPVTERAIPLAIFQAEPSVRKHYLRKWLKSPSLQDFNI
RAILDWDYYIERLGSTIQKIITIPAALQQVKNPVPRVRHPDWLHKKLLEKNDVYKQKKIN
ELFTSEGKRQVLANQPQEGTSSSQVGDIEDFGAAKRLQPSVPIANKRKRVPTAEESQEMS
QSLELSQSWREILGPPPSMGTTKEELVAWLRFHQKKWELQARQRRERQKRRRLEDGGSAA
GGGVVRDALSRGLGSYLRRTARSILDLPWQIVQIAETSQPGLFKLWAVIGSDLHCIKLSI
PRVFYVNQRVAKPEEGAVYRKVNRILPRSNLVYNLYEYSVPEDMYQEHINEINADLSAPD
IEGVYETQVPLLLRALIQLGCVCMVSRQLARHLTGREADTFDIEHLEMRSLAQFPYLEPG
SIRHIYLYHSSQGSRALFGLFVPAQRKAAVFVLDTVRSNQMPNLTTMFSAERSALLERVG
EELLPPDKHTFEVRAETDPKAICRAIQRLLLGYKDERRGPTLIAVQSNWELKRLASGIPI
LEEFPLVPIRVTDDISYSVLDWQRHAARRMIRHYLNLDTCLSQAFEMSRYYHIPIGNLPD
DISTFGSDLFFSRHLRRHNHLLWLSPTARPDLGGKEADDNRLVMEFDERASVEINNPGCY
STVCLELDIQSLAVNTVLQSHHVNDMEGGSSMSISFDVIQQASLEDMVTGNQAANIPASY
DETALCSNTFRILKSMVVSWVKEITQYHNIYADNQVIHFYRWLRSPSSLLYDPALHRTLH
NMMKKLFLQLVAEFRRLGSSVVYANFNRIILCTKKRRIEDAISYMEYIINSIHSKEIFHS
LTISFSRCWEFLLWMDPANYGGIKGKVHSRIHCGEKDTSNKQALEEGDSEEEEEVGEEDE
EDESNVEELLENSWNIVQFLPQAASCQNYFLMIVSAYIVAVYHSMKEELRRNAPGSTPVK
RRGTSQVTQEAQGETGAMPGMITFSQDYVANELTQSFFTITQKIQKKMSGSRHTTEPSDL
FPVLPGSYLPLNNPALEFIKYVCQVLSLDANVTNQVNKLRRDLLRLIEVGEFSDEAQFRD
PCRSYVLPEVICRNCNFCRDLDLCKDPALSQDGSVLPSWVCSNCQAQYDSDSIEMALVEA
LQKKLMAFMLQDLVCKKCHGVKDTHMPVYCSCAGDFALTISSQTFMEHITIFQNIARHYG
MAHLLETIEWLLHTNPQLQQ
NT seq 6903 nt   +upstreamnt  +downstreamnt
atgcagaaggggccccgctgtccccccgacctccaccgtgagctcaccggaacgctccgt
cctccacggccgtccccgcgcagcccaggagagcatcagaggatccgccggagctcggat
gatggccccgcgctgtccgccctcaagcgcttggagcggtcgcagcgcacggaccggctg
gacgcgctgttcggcttcgagcggccctccgagccctgcgagcggacgggctggcttatc
aacatgcacccgaccgaggtgctggatgaggaccggcgggcggtgagcgctgtggactat
tatttcatccaggaggacggcagccgcttcaaggtggccctgccatacagaccctacttc
tacgtggccacccagcagggctgcgagcgggaggtgtcctccttcctggccaagaagttc
caagggaagattgcgaagctggaaactgtcccaaaagaagatttggatctgcccaaccac
ctggtggggctgaagcggcactacctcaagctgtccttcagcacggtggatgagttggtg
aaggtgaggaaggagatctcccctgctgtaaggaagaacagggagcgtgaccatgccagt
gatgtgtacacatccatgctgtcaagtgctctggctggaggcagcctaaccacagcggag
gaaggagcctctaaaaaggtcaccaaccaaatggacaacattgtggacatgcgggagtat
gacgtgccctaccacgtgcggctctccatcgacctgaagatccacgtggctcactggtac
aacgtgcggtaccgcggcagcaccttcccccctgagatcacccgcagggatgacctggtg
gagcggccggatcccgttgtccttgcctttgacatcgaaaccaccaaactccccttgaag
tttcctgatgcggagacggaccagatcatgatgatctcctacatgattgatgggcagggc
tacctgatcacaaacagggagatcgtctctgaggatatagaagactttgagttcactccc
aagccagagtatgagggtcccttctgtgtctttaatgagccagatgaagctcatttaatc
cagaggtggtttgaacacgtccaggagaccaagcctaccatcattgtcacatacaatgga
gacttctttgactggccctttgtagaagcaagagctgcagctcatggaattaacatgtac
caggaaattggatttcagaaggacagccagggagagtacaaagcatcacagtgcatccac
atggactgcctaaggtgggtgaagagagacagttacctcccagtgggaagtcacaacctg
aaggcagcagctaaagcaaaactgggctacgacccagtggagctggaccctgaggagatg
tgccggatggctacagaggagcctcagaccctggccacctattcagtgtccgatgctgtt
gccacctattacatgtatatgaaatacgtgcaccctttcatttttgccttgtgcaccatc
atcccaatggagcccgatgaggtgttacgaaaaggttctgggacgctgtgcgaggcgctg
ctgatggttcaagcctatcatgccaacatcatcttccccaacaagcaggagcaggaattc
aacaagctcacagaggatggccacgtgctggattcagagacatacgttggaggccacgtg
gaagcactggagtcaggagtgttccgtagtgacatcccctgccgcttcaaaatgaaccct
gctgcctttgactacttggtgcagaacgtggagaagacactccggcatgctattgaggag
gaggaaggtttgccactggatcaagtcaccaacttccaggaggtctgtgatgaaatcaaa
gtcaaactgaattccctgaaggatgttcctaaccgaattgagtgtccccttatctaccat
ttggatgtgggggccatgtaccccaacatcattctgaccaacagattgcagccctcagca
atggtggatgaggccacatgtgctgcctgtgacttcaacaagccaggggccaactgccag
cgccggatgacgtggcagtggagaggagaattcatgcctgcgagccgcagtgagtaccac
cgcatccagcagcagttggagtcggagaagttccctccactctaccctgatggagcaccc
cgtgctttccacgagctctctcgagaggagcaagccaagtatgagaagaagcggctggca
gattactgccgcaaagcctacaagaagatccatgtcaccaaggtggaggagagggtcacc
accatctgccaacgagagaactccttctatgtggacacggtgcgagctttcagggaccgc
cgctacgagttcaaggggctgcacaaggtgtggaagaagaagctgtctgcagccatggag
acaggagatgcctctgaagtgaaacgctgcaagaacatggagatcctgtatgactccctg
cagttggcacacaagtgcattctcaattctttctatggctatgtcatgcggaaaggagct
cgatggtactccatggaaatggccgggattgtctgcttcacaggagccaatatcatcacg
caggccagggaactgattgagcagattgggaggcctctggaactggatacggatgggatt
tggtgcgtcctccccaacagcttcccagaaaactttgtcatcaagtcaaccaatgccaag
aagccaaaggtgacaatctcctacccaggtgctatgctgaacatcctggtgaaggaaggc
tttacaaatgatcagtaccaggagctgcaggacccagcttctctcacctatgtcacacgc
tcagagaacagcatcttctttgaagtggatgggccatacctggccatgatccttccagct
tccaaggaggagggaaagaaactgaagaaaaggtacgcagtgttcaatgaggatgggtcc
ctggctgagctgaagggctttgaggtgaagcgccggggcgagctgcagctggtgaagata
ttccagtcttctgtattcgaggccttcctgaaaggcaccaccctggaggaggtctatgct
tctgtggccaaggtggctgactactggctggatgtgctgtacagcaaggctgccaacatg
cccgattcggagctgtttgagctcatctcagagaaccgttccatgtctcgcaaactggag
gactatggggagcagaaatccacctccatcagcactgccaagcgcctggcagagttcctg
ggggaccagatggtgaaggatgcagggctgagctgccgcttcatcatctccaagaaaccc
gagggctctcctgtcactgagagggccatcccccttgccatcttccaagcagagcccagc
gtacggaaacactacctccggaaatggctgaagagcccctcgctgcaggacttcaacatt
cgggcgattctggactgggactactacattgagagactgggaagcaccatccagaaaatc
atcactattcctgcagcgctgcagcaggtaaagaacccggtgccacgggtccggcaccca
gactggctgcacaagaaactcctggagaagaatgatgtgtacaaacagaaaaagatcaac
gagctcttcacttctgaaggcaagaggcaggtcctcgccaaccagccccaggagggcaca
tccagctcacaggttggtgacatagaggattttggggctgccaagagacttcagccatcc
gttcccattgcgaacaaacggaagcgagtccctactgcagaggaaagccaagagatgtcc
cagagcttggagctgtcccagtcctggcgggagatcctgggtcctcctccctccatgggc
accaccaaggaggagctcgtggcctggctgcgtttccaccagaagaaatgggagctgcag
gcccggcagcgacgcgagcggcagaagaggcggcgcctggaggacggagggtcggcggcg
ggcggcggggtggtccgtgatgccctctccagggggctgggcagctacctgcgccgcacc
gcgcgcagcatcctggacctgccctggcagatcgtgcagatcgctgagaccagccagcct
ggcctgttcaagctgtgggcagtgattgggagcgacctgcactgcatcaagctgagcatc
cctagggtgttctacgtcaaccagcgcgtcgcaaagcccgaggagggagcggtctacagg
aaggtgaacaggatcctgccccgatcgaacctggtgtacaacctgtacgagtactcagtc
cctgaggacatgtaccaggagcacatcaacgagatcaacgctgacctctctgctccagac
atcgagggagtgtatgagactcaggtgccactgctgctgagggccctgatccagctgggc
tgtgtctgcatggtcagcaggcagctcgccaggcacctgacgggccgtgaggctgacacc
ttcgacatcgagcacctggagatgcgctcgctggcgcagttcccctacctggagccgggg
agcatccgccacatctacctctaccacagctcccagggcagcagggccctctttggcctc
ttcgtccccgcgcaacgcaaggctgctgtctttgtgctggacacggtgcgcagcaaccag
atgccaaacctcaccaccatgttctcagcggagcgcagcgcgctgctggaaagggtgggt
gaggagctgctgcctccagacaagcacaccttcgaagtgcgcgccgagaccgaccccaaa
gccatctgcagagccatccagcggctgctgctggggtacaaggatgagcgccggggtccc
acgttgattgccgtgcagtccaactgggagctgaagcggctggcgagcggcattcccatc
cttgaggagttccccctggtccccatccgggtgacagatgacatcagctactcagtgcta
gactggcagcgccacgcagcccgacgaatgatccgccattacctcaacctggacacgtgc
ctgtcccaggcctttgagatgagcagatattaccacattcccatcgggaacctccctgat
gacatctccacctttggctctgacctgttcttctcacggcacctccgtcgtcacaaccat
ttgctgtggctctcacccacggcccgcccggacctgggggggaaggaggctgatgacaac
cgcctcgtcatggagtttgatgagagagcctcggtggagataaacaaccctggctgctat
tccacggtgtgtctggagctggacatccagagcctggctgtgaacacagtgctgcagtcc
catcatgtaaatgatatggaaggaggttccagcatgagcatcagctttgacgtaattcag
caggcatccttggaagatatggtgacagggaaccaagctgccaacatcccagccagctat
gacgaaaccgccctctgctccaacacattcaggattctgaagagcatggtggtgagctgg
gtgaaggagatcacgcagtaccacaacatctatgcagacaaccaggtcattcacttttac
cgctggcttcgctctccttcctctctgctctacgacccggcgctgcaccgcacgttgcac
aacatgatgaagaagcttttcctgcagttggtggctgagttcaggcgcctcggctcttcg
gtggtgtacgccaacttcaaccggatcattctgtgcaccaagaagcggcgaatcgaggat
gccatcagctacatggagtacattattaacagcatccactcaaaggagatcttccactct
ctgactatttccttctcccgctgctgggagttcctgctctggatggatccagccaattat
ggaggtatcaagggaaaagtgcattctcgcatccactgcggggagaaggataccagcaat
aagcaagcactagaggagggagacagtgaggaagaggaggaggtaggggaagaagatgag
gaagatgaatccaacgtggaggagctgctggagaacagttggaacatcgtgcagttcttg
ccacaggctgcctcctgccagaactacttcctgatgattgtgtcggcctacatcgtggcc
gtgtaccacagcatgaaggaggagctgcgacgcaatgcccccggcagcactcctgttaag
agaagaggcaccagccaggtgacccaggaggcacagggcgagacaggagccatgcctggc
atgatcaccttctcacaggattacgtggccaatgaactcactcagagcttcttcaccatc
acgcagaagatccagaagaagatgtctggttcccgacacaccactgagccatcagacttg
ttcccagtgctgcctggctcctacttgccgctcaacaaccctgctctggagttcatcaaa
tatgtttgccaggtgctgtccctggatgccaatgtcaccaaccaggtgaacaagctgcgc
agggacctgctgcgcctcatcgaggtgggagagttctcagatgaagcccagtttcgggac
ccttgccgctcctacgtgctccctgaagtcatctgcagaaactgcaacttctgcagggac
ttggacctgtgcaaggacccagccctctcccaggacggatcggtgctgcctagctgggtg
tgttccaactgccaggcacagtacgactctgactccatagaaatggccttggtggaagcc
ctgcagaagaagctgatggccttcatgctgcaggacctggtgtgcaagaagtgccacggt
gtgaaggacacacacatgcctgtgtactgcagctgtgctggagactttgccctcaccatc
tcctcccagaccttcatggagcacatcaccatcttccagaacattgcccggcactatggc
atggcccatctgctggaaaccatcgaatggctgctgcacaccaacccccagctccagcaa
tga

KEGG   Meleagris gallopavo (turkey): 100549999
Entry
100549999         CDS       T01523                                 

Gene name
POLE3
Definition
(RefSeq) DNA polymerase epsilon subunit 3
  KO
K02326  DNA polymerase epsilon subunit 3 [EC:2.7.7.7]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp03030  DNA replication
mgp03410  Base excision repair
mgp03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    100549999 (POLE3)
   03410 Base excision repair
    100549999 (POLE3)
   03420 Nucleotide excision repair
    100549999 (POLE3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mgp03032]
    100549999 (POLE3)
   03036 Chromosome and associated proteins [BR:mgp03036]
    100549999 (POLE3)
   03400 DNA repair and recombination proteins [BR:mgp03400]
    100549999 (POLE3)
Enzymes [BR:mgp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     100549999 (POLE3)
DNA replication proteins [BR:mgp03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   DNA polymerase epsilon complex
    100549999 (POLE3)
Chromosome and associated proteins [BR:mgp03036]
 Eukaryotic type
  Chromatin remodeling factors
   CHRAC complex
    100549999 (POLE3)
DNA repair and recombination proteins [BR:mgp03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase epsilon complex
      100549999 (POLE3)
SSDB
Motif
Pfam: CBFD_NFYB_HMF Histone SpoU_methylase CENP-T_C CIS_TMP BUD22 RNA_pol_3_Rpc31 DUF4746 Afi1 NOA36 CDC45 CobT
Other DBs
NCBI-GeneID: 100549999
NCBI-ProteinID: XP_010719028
Ensembl: ENSMGAG00000001864
LinkDB
Position
19
AA seq 143 aa
MAERPEDLNLPNAVITRIIKEALPDGVNISKEARSAISRAASVFVLYATSCANNFAMKGK
RKTLNAGDVLSAMEEMEFQRFIAPLKESLEVYRREQKGKKEARKDKDKKADSEEQDKSRE
DDNDDDDERMEEEEQNDEEEVDN
NT seq 432 nt   +upstreamnt  +downstreamnt
atggcggagagaccggaggatctcaacctgcccaacgccgtcatcacccgcatcatcaaa
gaggcgctgcctgatggggtgaacatatccaaagaagctcggagcgcaatatctcgagca
gcaagtgtgtttgtgctgtatgcaacatcatgtgcaaataactttgccatgaaggggaag
aggaaaacgctgaatgctggtgatgttctctctgccatggaggaaatggagtttcagcga
tttatagcccctttgaaagagtccctggaagtttacagacgtgaacagaagggaaagaaa
gaagcgaggaaagataaagacaagaaggcagactcagaggaacaagataagagccgagaa
gatgataatgatgatgatgatgaaaggatggaggaagaagagcaaaatgatgaggaagag
gtggacaactga

KEGG   Meleagris gallopavo (turkey): 104914653
Entry
104914653         CDS       T01523                                 

Gene name
POLE4
Definition
(RefSeq) DNA polymerase epsilon subunit 4
  KO
K03506  DNA polymerase epsilon subunit 4 [EC:2.7.7.7]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp03030  DNA replication
mgp03410  Base excision repair
mgp03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    104914653 (POLE4)
   03410 Base excision repair
    104914653 (POLE4)
   03420 Nucleotide excision repair
    104914653 (POLE4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mgp03032]
    104914653 (POLE4)
   03400 DNA repair and recombination proteins [BR:mgp03400]
    104914653 (POLE4)
Enzymes [BR:mgp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     104914653 (POLE4)
DNA replication proteins [BR:mgp03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   DNA polymerase epsilon complex
    104914653 (POLE4)
DNA repair and recombination proteins [BR:mgp03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase epsilon complex
      104914653 (POLE4)
SSDB
Motif
Pfam: CBFD_NFYB_HMF Histone CENP-T_C TFIID-31kDa TAF DUF4037
Other DBs
NCBI-GeneID: 104914653
NCBI-ProteinID: XP_019465533
LinkDB
Position
30
AA seq 75 aa
GAGPGAGLRSAPFLRATLRVLCPQELFVETIAKDAFVYAQQGKRKTLQRKDLDNAIEAVD
EFAFLEGGAVAELLS
NT seq 228 nt   +upstreamnt  +downstreamnt
ggagcgggtccgggcgcggggctccgttccgctccgttcctccgtgcgacgctgcgcgtt
ttgtgcccgcaggagctgttcgtggaaaccatcgctaaggacgcctttgtgtacgcccag
cagggcaagaggaaaaccctgcagaggaaggacctggataacgccatcgaggccgtcgat
gagtttgcctttttggaaggcggtgctgttgctgagttgctgtcctga

DBGET integrated database retrieval system