KEGG   Meleagris gallopavo (turkey): 100539759
Entry
100539759         CDS       T01523                                 

Gene name
CCND1
Definition
(RefSeq) LOW QUALITY PROTEIN: G1/S-specific cyclin-D1
  KO
K04503  G1/S-specific cyclin-D1
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp04068  FoxO signaling pathway
mgp04110  Cell cycle
mgp04115  p53 signaling pathway
mgp04218  Cellular senescence
mgp04310  Wnt signaling pathway
mgp04340  Hedgehog signaling pathway
mgp04371  Apelin signaling pathway
mgp04510  Focal adhesion
mgp04530  Tight junction
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100539759 (CCND1)
   04340 Hedgehog signaling pathway
    100539759 (CCND1)
   04371 Apelin signaling pathway
    100539759 (CCND1)
   04068 FoxO signaling pathway
    100539759 (CCND1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100539759 (CCND1)
   04115 p53 signaling pathway
    100539759 (CCND1)
   04218 Cellular senescence
    100539759 (CCND1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100539759 (CCND1)
   04530 Tight junction
    100539759 (CCND1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 100539759
NCBI-ProteinID: XP_010709511
Ensembl: ENSMGAG00000009911
LinkDB
Position
5
AA seq 292 aa
MEHQLLCCEVETIRRAYLDANLLNDRVLQTMLKAEETCSPSVSYFKCVQKEILPYMRKIV
ATWMLEVCEEQKCEEEVFPLAMNYLDRFLSFEPLKKSRLQLLGATCMFVASKMKETIPLT
AEKLCIYTDNSIRPDELLQMELLLVNKLKWNLAAMTPHDFIEHFLTKMPLAEDTKQIIRK
HAQTFVALCATDVKFISNPPSMIAAGSVVAAVQGLHLGNTNTFLSYQCLTHFLSQVIKCD
PDCLRACQEQIESLLESSLRQAQQHNVSSETKTVEDEADLSCTPTDVRDVNI
NT seq 879 nt   +upstreamnt  +downstreamnt
atggaacatcagctgctgtgctgcgaggtggagaccatccgacgagcctacctggacgcc
aacctgctcaatgacagggtgctgcagaccatgctgaaggcggaggagacctgctcgccc
tcggtgtcctacttcaagtgcgtgcagaaggaaatcttgccatatatgaggaaaatagtc
gccacttggatgctggaggtctgcgaggagcagaagtgcgaagaggaagttttccccttg
gcgatgaattacttggacagatttttgtcgttcgaacccctcaagaaaagccggttgcaa
ttgctcggagctacctgcatgtttgtggcttccaaaatgaaggaaacgattcctctgacc
gcggaaaaactgtgcatttataccgacaactccatcagacccgacgagttactgcaaatg
gagctgctgctggtgaataagctgaaatggaatctggctgcaatgaccccccacgatttc
attgaacatttcctcactaaaatgcctctggcagaggacaccaaacagatcatccgtaaa
catgctcagacttttgtggctctgtgcgctacagatgttaaatttatttcaaacccacct
tccatgatcgcagctggcagtgtggtagcagctgtgcaaggcctgcatctggggaacact
aacactttcctctcctatcaatgcctcacacatttcctatcacaagttatcaaatgtgat
ccggattgtttacgagcctgccaagaacagattgaatccctccttgaatccagtctacgc
caggcacagcagcacaacgtatcttcagaaacaaagactgtagaggatgaagcagacctt
tcctgcacacccactgatgtgcgagatgtgaacatttaa

DBGET integrated database retrieval system