KEGG   Meleagris gallopavo (turkey): 100539794Help
Entry
100539794         CDS       T01523                                 

Gene name
TUBGCP6
Definition
(RefSeq) tubulin gamma complex associated protein 6
  KO
K16573  gamma-tubulin complex component 6
Organism
mgp  Meleagris gallopavo (turkey)
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mgp03036]
    100539794 (TUBGCP6)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mgp04812]
    100539794 (TUBGCP6)
Chromosome and associated proteins [BR:mgp03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Microtubules and associated factors
    gamma-tubulin ring complex
     100539794 (TUBGCP6)
Cytoskeleton proteins [BR:mgp04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Gamma-tubulin complex components
     100539794 (TUBGCP6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GCP_C_terminal GCP_N_terminal DUF4573
Motif
Other DBs
NCBI-GeneID: 100539794
NCBI-ProteinID: XP_010704465
Ensembl: ENSMGAG00000008013
LinkDB All DBs
Position
1
AA seq 1737 aa AA seqDB search
MESITQLFNDLCEAHLTGLPWKVHLGRQKISKRKAKQNLKRVVYNTLFINLFQDEARKLQ
SNISRLPVKNKILMLSFNLRVGGLGAQADRLESLVEELEAAEGLPFTEVNAVLDLFVQLA
GTGPPQLVPQKKDYFLNNKYVGRNVKYQGYDYYDVSVFEADIQSLITNEECQFNDTIQKT
LQIMEAAPGTGLPAIGLFSQNYPVGDKFERETRVSLFGALVHSRTYDMDIKLDLPPVPDN
ADLSGLAIKVPQSIDQSEDEGFQSASNLTPDSQSEPSMTPDIDLWDAVLTYGPSKRRCWE
RIGYPPGKKEEPYLTEAGREAFDKFYKLREGEMQLFSSTVLQLPQLVLMREPELVKDVLN
VLIGVVSTTFSLNQAAQTFIIKEGVYVSGTSPETMHNLLSEVAEYGTYYTRLSRFSLQPV
LDSSYSKGLVFQAFTSGLRKYLQYYRACVLSTPPTLSLLTISFLFRKLGRQLRYLAELCG
IGTTALGISGGAGASFPTGVKLLSYLYKEALNNCSNEHYPVLLSLLKTSCEPYTRFIYDW
VYSGVFRDVYGEFMIQVNEDYLCFRDKHYWTHGYVLISKEVEDCVPVFLKHIANDVYICG
KTINLLKLCCPRHYICWSDIPVPRISVIFSLEELKEIERDCAVYVGRMERIARYSSISKE
EKDLRMEIAKQELIVHARETASKVLKAINDRQISERMALDAKKREQFQKLKEQFAKDQER
RLAIKQEEIDDDFSYARELREREKRLKALEEELEKKARQELIDHYSKLSDDAARREQRAL
WKIQRHKLETARLKFLFEDQKRIEEMLEKLPDGSYRRKLDIIPYKQCQLALDRSTAVEDP
HSQVSAVKPLHSNERVGRKESESGLEYVTSTDKPLAVPQLANTNADQHFQPKPAGSEGDL
QSSEQARSPLRTADSSPESSVNVEDFLPKPQDEQPVAISLQGSLLDEALRNINSDLSETP
QIGENQPVSRGEGDTLLHQQNEYDFNTVLRPTAALQGHIRVGENVFDVESRRPRWNIHGH
ASNANIRVGEYVPEVDAYQPRSSPYGHSSDSHIEISSYTSEVESTRPRWNIHGHVSEAHI
KIGEYASEVEPSRPRWSIHGHASEASIRVGEYVSNVAPARPRWNIHGHVSDANIKIGENV
SEVVSARPRWNIHGHSSQSHIKIGELVSDTQPLKSRWSPFGHASQSSIQIGKWTPSTEDD
PIPHRKAISGPSSDSTVQTLLYNEELSPSGEIRKETKPSQAKESISPQSSDIDPVSPDAK
NDKKENTVEEKQEVIADEVDKDPSPDSSQSLQAEEREKAIPQDTVPQEALFSEPSASKTK
DEEGGEEDAWKKEQAYLKALSDQYCIEKYQDSYDLMSELPVSHLLHHVIPRSYTFPVDPM
VQSATDETAVQLSELLSLPVLMKRSITAPLVSHVSLVNKAIVDYYFVELNVEKHFEALRH
FLLMEDGEFAQSLSDLLFEKLGSGQTPGELLNPLVLNSILNKALQYSLHGDTQLASNLSF
ALKYLPEVFKPNAPDALSCLELRYKVDWPLNIVITESCMNKYNKIFSFLLQLKHMVWTLK
DVWFHLKRTALVSHASNSVQFRQLQLYKHEMQHFVKVIQGYIANQILHVTWCEFGNKLSS
VGNLEEIHRTHAEYLNKAIFRGLLTEKAAPVMNIIHSIFSLILKFRSQLISQSWSFDAGK
QMAVHPNFGLMQQSYNTFKYYSHFLFKVVTKLVNRGYQPHLEDFLLRINFNNYYKDN
NT seq 5214 nt NT seq  +upstreamnt  +downstreamnt
atggagagcattacacagctgttcaatgacctgtgtgaggcacacctgacgggtttgcca
tggaaggtgcacctgggcaggcagaagatcagcaagaggaaggctaagcaaaacctgaag
agggttgtgtataacactctgttcataaacctttttcaagatgaagcacgtaagctgcaa
tcaaacatttccaggcttccagttaaaaacaagattttgatgttgtctttcaacctgaga
gtcggtggcctaggagctcaggcagatagactggagagtcttgtggaggagctggaagca
gccgagggcttaccatttactgaggttaatgctgtcctggatctctttgtacagcttgct
ggaacaggtcctccacagcttgtaccacaaaaaaaggactattttctgaacaacaaatat
gtcgggagaaatgtcaagtatcagggttatgattattacgatgtaagtgtgtttgaagcc
gatatacagtctctaataacaaatgaagaatgtcagttcaatgacacaattcagaagacg
cttcagatcatggaggctgcccctggaacaggactccctgccatagggttgttctcacag
aactatcctgttggggacaagtttgagagagaaacacgcgtctcgctctttggtgctctt
gtccacagccgtacttatgacatggacatcaagttggatttgccaccagtgcctgacaat
gcagatttgtctggacttgcaattaaagttcctcaaagcatagaccagtcagaagatgaa
ggattccagtcggcatccaatctgactcctgattctcagtcagagccaagcatgactcca
gacatagatctgtgggatgcagtgcttacatatgggccaagcaaacgaagatgctgggaa
agaattggatacccacctggtaaaaaggaagagccgtaccttactgaggctgggagagaa
gcttttgacaaattctacaaactccgagaaggggaaatgcagctcttcagtagtactgtg
cttcagcttccacagcttgtgctgatgagggaacctgaactagtgaaggatgtcttgaat
gtcctcattggtgtggtatccactacattttcactcaatcaggctgctcaaacatttatt
ataaaggagggggtatatgtgtctggaacttcaccagagacaatgcacaacctgctctca
gaagttgcagaatatggaacttactacacacggctgagtcgcttctctcttcagccagtc
ttagattcttcgtacagcaaagggcttgtgtttcaggctttcacaagtggtctgagaaag
tatcttcagtattaccgagcctgtgttttgtctactcctcctactttaagtcttctgaca
atcagctttctcttcaggaaattgggtcgtcagttgagatatctggctgaactttgtggc
ataggaacaacagcactggggatcagtggtggagctggtgcttcatttcctacgggtgtg
aaattgctttcatatctgtacaaagaggccctcaacaactgtagcaatgaacactatcca
gtccttctgtctttgttaaagacaagttgtgagccatacacaagatttatctatgattgg
gtatacagtggtgtattcagggatgtttacggagagtttatgatccaagtgaatgaggat
tatctttgtttcagagataaacattactggactcatggttacgtcttgatttcaaaagaa
gtagaagattgtgtccctgtatttcttaaacatattgctaatgacgtgtatatatgtggg
aaaaccataaacctgctgaagttgtgttgtcccaggcattacatatgttggtcagatata
cctgtaccccggatttctgttattttttcactcgaggagctgaaagaaattgagagagat
tgtgcagtgtacgtaggtcggatggaaagaattgctcggtacagttctataagcaaagag
gaaaaggatttgcgcatggaaatagccaagcaagaattaattgttcatgcacgagagact
gctagcaaagtactaaaagccattaatgatcggcagatatcggaacgaatggctttagat
gcgaagaaacgtgaacagtttcagaagttgaaagagcaatttgcaaaagaccaagagcgt
cgccttgctataaagcaagaggagattgatgatgatttcagctatgcccgagagctcaga
gaaagagaaaaaagactgaaagctttggaagaggagctagaaaaaaaggcaaggcaagag
ttaattgaccattatagcaaactttctgatgatgcagcccgtagggaacaaagagcttta
tggaaaatccagcgacacaagttggaaacagctcgtcttaagtttctctttgaagatcag
aaacgtattgaggaaatgcttgaaaaacttccagatggaagctacaggaggaaattagat
attattccttataaacagtgccagctggctttggatagaagcactgctgtggaagatcca
cattcacaggtgtcagctgtgaaacctttgcattctaatgaacgagttggcagaaaagaa
tctgaatctggactggaatacgttacatctactgacaaaccattggccgtgccacagctg
gcaaatactaatgctgatcagcattttcagcctaaacctgcaggatctgaaggtgatcta
cagagttcagagcaagcacgcagccccctacgtactgctgattcttctcctgaatccagt
gtgaacgtagaagatttcttaccaaagccacaagatgagcaacctgttgccattagctta
caaggatctctgctagatgaagcacttagaaatattaactcagatctgtcagagactcct
caaataggtgaaaatcagcctgtctcgagaggagaaggtgatacattgctacatcagcaa
aatgagtatgattttaacactgttctcaggccgactgctgctttgcaggggcacattaga
gttggagaaaatgtatttgatgtggagtctagaaggcctcggtggaacatccatgggcat
gcatctaatgccaatatcagagtgggagaatatgtgcctgaggtggacgcttaccagcca
cgttcaagtccttatgggcattcttcagactcccatatagaaatcagcagctatacctca
gaagttgaatctactcgaccccgatggaatattcatgggcatgtttctgaagctcatatt
aaaattggggaatatgcttcagaggtagagccctcaagacctaggtggagcattcacggg
catgcttcggaagccagtattagggttggtgaatatgtgtcaaatgttgctcctgcaagg
cctcggtggaacatccatggtcacgtgtctgatgccaatattaagattggtgagaatgtg
tcagaggttgtctcagctaggcctcgttggaacatccacgggcattcttcacagtcacac
atcaaaattggagagctagtttcagatacacagcctctgaaatctcgttggagcccgttt
ggtcatgcatcccagtcaagcatccaaatagggaagtggactccgtctacagaggatgat
cccatacctcatcgtaaagcaatttctggtccttcatctgattccacagttcagacactt
ctatataatgaagaattatctccttctggagagatcagaaaggaaacaaaaccatcacaa
gctaaggaaagtatttcaccacagtcatctgacattgatcctgtctctcccgatgctaaa
aatgacaaaaaggaaaatacagtggaagagaagcaagaagtaattgcagatgaggttgac
aaggacccttctccagattcatcacagagcttacaggcagaagaacgtgaaaaggcaatt
ccacaggatactgtgcctcaagaagctttattttctgaacccagtgcttccaagactaag
gatgaggaagggggagaggaagatgcatggaagaaagaacaagcttatttgaaagcatta
tcggatcaatactgcattgaaaagtaccaagatagttatgatttaatgtcagagctacca
gtttcccatctcttgcaccatgtgataccaagatcatacacttttcctgtggatcctatg
gtacagtcagcaacagatgaaacagctgtacaactgagtgagctcctatctctgcccgtg
ctgatgaaacgttctattactgccccactggtatctcatgtttctcttgtgaacaaagca
atagttgattactacttcgtggaactgaatgtagagaagcattttgaagcactgagacac
ttcctgttaatggaagatggggagtttgctcagtcactcagtgacctgttgtttgagaag
cttggatcaggacagacgcctggtgaactgctgaatccgctggttcttaattctatccta
aacaaagcattacagtacagtcttcatggtgacacccagcttgcttccaatctttctttt
gccctcaagtaccttccagaagtgttcaagcccaatgcacctgatgctctgagctgctta
gagctaaggtacaaggttgactggcctctgaatattgtcataacagagagctgcatgaat
aaatacaacaagatcttctcctttttgcttcagttgaagcacatggtgtggactctcaag
gatgtgtggtttcacttaaaacgcactgcattagtgagtcatgcatcaaattctgttcag
tttcgacagctgcagctgtataaacatgaaatgcagcattttgtgaaagttattcaaggt
tacattgctaatcagattcttcatgttacgtggtgcgaatttggaaacaaactgtcttct
gtgggcaatttggaagaaattcacagaacacatgctgaatacctcaacaaagcaattttc
aggggtctgttgactgagaaggctgccccagtgatgaacatcatacacagcatcttcagc
ctcatcttgaagttccgcagccagctgatctctcagtcatggagctttgatgctgggaag
caaatggctgttcatcccaactttggtttgatgcagcagtcgtacaatactttcaagtat
tactctcacttcttattcaaagtggtaacaaagcttgtaaatagaggataccagccacat
ttggaggacttcctactgcgaatcaacttcaataactactacaaggataactga

DBGET integrated database retrieval system