KEGG   Meleagris gallopavo (turkey): 100540024Help
Entry
100540024         CDS       T01523                                 

Gene name
COLGALT2, GLT25D2
Definition
(RefSeq) collagen beta(1-O)galactosyltransferase 2
  KO
K11703  collagen beta-1,O-galactosyltransferase [EC:2.4.1.50]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp00310  Lysine degradation
mgp00514  Other types of O-glycan biosynthesis
mgp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    100540024 (COLGALT2)
  09107 Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    100540024 (COLGALT2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:mgp01003]
    100540024 (COLGALT2)
Enzymes [BR:mgp01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.50  procollagen galactosyltransferase
     100540024 (COLGALT2)
Glycosyltransferases [BR:mgp01003]
 O-Glycan biosynthesis
  O-linked Gal type
   100540024 (COLGALT2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_transf_25 Glyco_tranf_2_4 Aminotran_4
Motif
Other DBs
NCBI-GeneID: 100540024
NCBI-ProteinID: XP_010714140
Ensembl: ENSMGAG00000001464
LinkDB All DBs
Position
10
AA seq 506 aa AA seqDB search
MEDPQSYPEEMGPKHWPSSRFTHVMKLRQAALRAAREKWSDYVLFLDTDNLLTNPETLNL
LIAENKTLVAPMLESRFLYSNFWCGITPQGYYKRTLDYPLIREWKRTGCFAVPMIHSTFL
IDLRKEASTKLMFYPPHQDYTWSFDDIMVFAFSSRQAGIQMFICNREHYGFLPMPLKSHQ
TLQEETENFVHTLIEAMIDRPPIEPSQYVSVPPKHPDKMGFDEIFMINLKRRKDRRDRML
RTLYEQEIAVKIVEAVDGKALNTSQLKALSIDMLPGYRDPYSSRPLTRGEIGCFLSHYYI
WKEVLNRGLEKTLVIEDDVRFEHQFKRKLMKLMDDIEQAQLDWELIYIGRKRMQVQQPEK
AVPNVMNLVEADYSYWTLGYAISFQGAQKLIGAEPFSKMLPVDEFLPVMYNKHPVAKYME
YYESRDLKAFSAEPLLVYPTHYTGQPGYLSDTETSTIWDNETVSTDWDRTHSWKSRQQGQ
IHSEAQNKDALPPQSSLNAPSSRDEL
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atggaagacccacagtcttacccagaagaaatgggaccgaagcattggccgagttcccgt
ttcacacacgtgatgaagctgaggcaggctgccctgcgtgctgcgcgggagaagtggtca
gactatgttctgtttctcgatacggataatttgctgaccaacccagaaactctgaacctg
ctgatagcagaaaacaagaccttggtggcaccgatgctggagtctcgctttctgtattcc
aacttctggtgtggcatcaccccccagggctattacaaaaggaccctggattaccccttg
atccgggagtggaagaggacgggctgttttgctgtcccgatgatccattccacattcctc
attgacctgaggaaggaggcctccaccaagctgatgttctacccgccccaccaggactac
acctggagctttgatgatatcatggtctttgccttctccagtcgccaagcaggaattcag
atgttcatctgcaaccgcgagcactacggtttccttcccatgcccctgaagtcgcaccag
acgctgcaagaagagacagagaactttgtgcacacactgattgaggctatgatcgatcgt
cctcccattgagccttctcagtacgtctccgttcctccaaagcaccctgacaagatggga
tttgatgaaattttcatgatcaatctgaagcgtcggaaggacaggcgggaccggatgctg
cggacgctttatgagcaggagattgcagtcaagatcgtggaggctgtggatggaaaagca
ctgaacacgagtcagctcaaagctctcagcatcgacatgctgccggggtaccgggacccc
tactcctcccggccgctgaccaggggagagatcggctgcttcctcagccattactacatc
tggaaggaggtgttgaacagaggactggagaagactctcgttattgaggacgacgtgcgc
tttgaacaccagtttaagaggaagctgatgaagctgatggatgacatagaacaagctcag
ctagactgggagcttatctacattggccggaaaaggatgcaggtgcagcagcctgagaaa
gcagttcccaatgtcatgaatctggtggaagctgattactcatattggaccctggggtat
gcaatctctttccaaggggctcagaagctaattggggcagagcctttcagcaagatgctg
cctgtggatgagtttctgccagtcatgtacaacaagcaccctgtagcaaagtacatggag
tattacgagtccagagacttgaaggccttttcagcagaacccttgctcgtttaccccacc
cactacacagggcagccaggctacctcagtgacacagagacctccaccatctgggacaac
gagaccgtgtcaacggactgggacaggacacactcctggaagtcacggcagcagggccag
atccacagcgaggcacagaacaaggacgccctgccgccccagtcctccctcaacgcgccg
tcctccagggatgagctatga

DBGET integrated database retrieval system