Meleagris gallopavo (turkey): 100540225 Help Entry 100540225         CDS       T01523                                  Symbol INS Name (RefSeq) insulin   KO K04526   insulin Organism mgp  Meleagris gallopavo (turkey) Pathway mgp04010   MAPK signaling pathway mgp04068   FoxO signaling pathway mgp04114   Oocyte meiosis mgp04140   Autophagy - animal mgp04150   mTOR signaling pathway mgp04810   Regulation of actin cytoskeleton mgp04910   Insulin signaling pathway mgp04914   Progesterone-mediated oocyte maturation Brite KEGG Orthology (KO) [BR:mgp00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     100540225 (INS)    04068 FoxO signaling pathway     100540225 (INS)    04150 mTOR signaling pathway     100540225 (INS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     100540225 (INS)   09143 Cell growth and death    04114 Oocyte meiosis     100540225 (INS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     100540225 (INS)  09150 Organismal Systems   09152 Endocrine system    04910 Insulin signaling pathway     100540225 (INS)    04914 Progesterone-mediated oocyte maturation     100540225 (INS)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mgp04052]     100540225 (INS) Cytokines and neuropeptides [BR:mgp04052]  Neuropeptides   Neuropeptides (Unclassified)    100540225 (INS) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Insulin Ins_beta Motif Other DBs NCBI-GeneID:  100540225 NCBI-ProteinID:  XP_003206326 Ensembl:  ENSMGAG00000007939 UniProt:  G1N7C1 LinkDB All DBs Position 5:10756538..10761192 Genome browser AA seq 107 aa AA seqDB search MSLWIRSLPLLALLVFSGPGTSYAAANQHLCGSHLVEALYLVCGERGFFYSPKARRDVEQ PLVSSPLRGEAGVLPFQQEEYEKVKRGIVEQCCHNTCSLYQLENYCN NT seq 324 nt NT seq  +upstreamnt  +downstreamnt atgtctctctggatccgatcactgcctcttctggccctccttgtcttttctggccctggg accagctatgcagctgccaaccagcacctctgtggctcccacttggtggaggctctctat ctggtgtgtggagagcgtggcttcttctactcccccaaagcccgacgggatgtagagcag cctctagtgagcagtcccctccgtggtgaggcaggagtgctgcccttccagcaggaggaa tacgagaaggtcaagcgagggattgttgagcaatgttgccataacacgtgttccctctac caattggagaactactgcaactag

DBGET integrated database retrieval system