KEGG   Meleagris gallopavo (turkey): 100540244Help
Entry
100540244         CDS       T01523                                 

Gene name
KMT5A
Definition
(RefSeq) lysine methyltransferase 5A
  KO
K11428  histone-lysine N-methyltransferase SETD8 [EC:2.1.1.43]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    100540244 (KMT5A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mgp03036]
    100540244 (KMT5A)
Enzymes [BR:mgp01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     100540244 (KMT5A)
Chromosome and associated proteins [BR:mgp03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     100540244 (KMT5A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET LAP1C
Motif
Other DBs
NCBI-GeneID: 100540244
NCBI-ProteinID: XP_019476560
Ensembl: ENSMGAG00000003253
LinkDB All DBs
Position
17
AA seq 275 aa AA seqDB search
MYHEVKCQGKALTETNRKGDEKKNGGNVIEGATKPEDQKDKESGCNTSVLSSDQKTQGTV
EAEKTLLPSDCAGEASAKPAQKKMVKTKRGPRRKTQGRAPNRKVTDYYPVRRSSRKSKSE
LETEERRKIDELITSGKEEGMKIDYIDGKGRGVIATKHFNRGEFVVEYHGDLIEITDAKK
REALYAQDPSTGCYMYYFQYLSKTYCVDATKETNRLGRLINHSKCGNCQTKLHDIDGVPH
LILIASRDIKAGEELLYDYGDRSKASIEAHPWLKH
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgtatcacgaagtgaaatgtcagggcaaagcgctaactgaaaccaacaggaaaggagat
gaaaaaaagaatggtggcaatgtaattgaaggtgctacgaaaccagaagaccagaaagat
aaggaaagtgggtgcaatacctcagtgctctcttctgatcaaaaaacccaaggaactgta
gaagctgagaagacactcctgccctcagactgtgctggtgaggccagtgcaaagccagct
cagaagaagatggttaaaacaaaacgtggaccaagaaggaaaacacaaggaagagcaccg
aatcgaaaagtgacagattattacccagttagaagaagctccaggaagagcaaatctgaa
ctggagactgaggaaaggaggaaaattgatgaactaattacaagtgggaaagaagaagga
atgaagattgattacattgatggcaaagggagaggagtaattgctactaaacattttaat
cgtggcgaatttgtagttgaatatcatggagatctcatagagatcactgatgctaaaaag
cgggaggctctgtatgctcaagatccatccacaggctgctatatgtactattttcagtac
ctcagcaaaacgtactgtgttgatgctacaaaagaaactaatcgtctgggaagactgatt
aatcacagcaaatgtggcaattgtcaaacaaagcttcatgacattgatggtgtgcctcat
ctcatattgatagcttccagagacattaaagcaggtgaagaactgttgtatgactatgga
gacagaagcaaagcttccattgaagctcatccatggctaaaacactaa

DBGET integrated database retrieval system