KEGG   Meleagris gallopavo (turkey): 100540554
Entry
100540554         CDS       T01523                                 

Gene name
EGR1
Definition
(RefSeq) early growth response protein 1
  KO
K09203  early growth response protein 1
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp04371  Apelin signaling pathway
mgp04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    100540554 (EGR1)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    100540554 (EGR1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mgp03000]
    100540554 (EGR1)
Transcription factors [BR:mgp03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 SP/KLF family and related proteins
    100540554 (EGR1)
SSDB
Motif
Pfam: DUF3432 DUF3446 zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-C2HC_2 zf-BED Zf_RING zf-H2C2_5 zf-C2H2_8
Other DBs
NCBI-GeneID: 100540554
NCBI-ProteinID: XP_010717506
LinkDB
Position
15
AA seq 510 aa
MAAAKAEMQLLPSLQISDPFGVFPHSPPAMDGHYPKLEEMMLLSGGGQQFLAPSGAPESA
GFGVAGEPGEQHFEHLAADTFPEISLNNEKTMPETSYSNQTTRLPPITYTGRFSLEPAPN
SSNSLWPEPLFSLVSGLVSMANAPPTSTPSSSSPSSSQSTPLSCSVQASENSPIYSAAPT
FPTSSSDIFPEPQTQSFPNPSGVPIQYPPPAYPTAKTNFQVPMIPDYLFSQQQSELNLIS
ADQKPFSALETRAQQPSLTPLSTIKAFATQTGSQELKTLNTNYQSQLIKPSRMRKYPNRP
SKTPPHERPYACPVESCDRRFSRSDELTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIR
THTGEKPFACDICGRKFARSDERKRHTKIHLRQKDKKVEKAASVSTTSSPVAAYSSSVAT
SYSSSIATTYPSPVRTVYSSPASSSYPSPAHTAFPSPSVATTYPSVTATFQTQVATSFPS
PGVTNNFSSQVTSALSDMTSTFSPRTIEIC
NT seq 1533 nt   +upstreamnt  +downstreamnt
atggctgcggccaaggcagagatgcagctcctgccctcgctgcagatctccgaccccttc
ggcgtctttccgcactcgcctcccgccatggacggccactatcccaaactggaggagatg
atgctgctcagtggcgggggacagcagtttcttgcgccttccggggcgcctgagagtgcg
ggcttcggcgtggccggggagcccggcgagcaacactttgagcacctcgcggcagacact
ttccctgagatctccctgaacaacgagaaaaccatgccagaaaccagctattccaaccaa
acaacacggctaccaccaattacctacacggggcgcttctccctagagccagccccaaac
agtagcaactccttatggccagagcccctcttcagccttgtcagtgggctggtgagcatg
gctaatgcacctcccacctctacaccttcttcatcatcgccctcctcttcgcagagtacc
cccctgagctgttctgtccaagccagtgagaacagtccaatttattcggctgcaccaact
ttccccacttccagctctgatattttccctgaaccacagacccagtcctttcccaacccc
tctggagtccccatccagtatccacctccagcttatccgactgctaaaaccaacttccag
gtgccaatgatcccggattacctgttctcgcagcaacagagtgagctcaaccttatctca
gctgatcagaagcccttctcagcccttgagaccagagcacagcagccttccctcacaccg
ctgtccactatcaaggcatttgccacacagactggctctcaggagttgaagaccctcaac
actaactatcagtcccagctaatcaagcccagcaggatgaggaaataccctaatcgtccc
agcaagacacctcctcatgaacggccctatgcttgcccagtggagtcctgcgaccggcga
ttttcacggtctgatgaactaactcgtcacattcgcatccacactggacagaaacctttc
caatgccgcatttgcatgcggaacttcagcaggagtgaccacttgaccacacacatccgc
acacacacaggagagaagccatttgcatgtgacatttgtggcagaaagtttgccagaagt
gatgagaggaagagacacactaaaatccatcttaggcagaaggacaagaaagtggaaaag
gcagcttcagtctcaactacttcttcccctgttgctgcctactcatcctctgtggctaca
tcctactcttcctccatagccaccacttacccctcaccagtgcgcacagtgtattcctcc
cctgcttcctcttcctatccctcccctgcacacacggcattcccatccccatctgtagca
accacttacccctctgtcactgccacttttcagacccaagtggccacttccttcccatct
cctggggttaccaataatttcagctcacaggtgacttcagcactttcagacatgacatca
accttttctccaaggacaattgagatttgctaa

DBGET integrated database retrieval system