KEGG   Meleagris gallopavo (turkey): 100540586
Entry
100540586         CDS       T01523                                 

Gene name
ADGRB1
Definition
(RefSeq) adhesion G protein-coupled receptor B1
  KO
K04596  adhesion G protein-coupled receptor B1
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    100540586 (ADGRB1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mgp01002]
    100540586 (ADGRB1)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mgp04131]
    100540586 (ADGRB1)
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mgp04030]
    100540586 (ADGRB1)
Peptidases and inhibitors [BR:mgp01002]
 Mixed peptidases
  Family P2
   100540586 (ADGRB1)
Membrane trafficking [BR:mgp04131]
 Endocytosis
  Phagocytosis
   Others
    100540586 (ADGRB1)
G protein-coupled receptors [BR:mgp04030]
 Adhesion receptor family
  Brain-specific angiogenesis inhibitor (BAI)
   100540586 (ADGRB1)
SSDB
Motif
Pfam: GAIN TSP_1 TSP1_spondin TSP1_ADAMTS HRM TSP1_CCN
Other DBs
NCBI-GeneID: 100540586
NCBI-ProteinID: XP_019469931
LinkDB
Position
3
AA seq 601 aa
MSSDAALLNQDPNDLQERAAAAFRNVNGEQGTHSKHSRGCQLCFSRLLSFNEMLILQSTE
EKEAKEKGGSKRKALAEKKKCMHGTWDEWSPWSLCSSTCGRGYRDRTRTCKPPQFGGNPC
EGPEKQTKFCNIALCPVDGNWNEWSSWSSCSASCSNGTQQRTRECNGPSYGGAECQGHWV
ETRDCFLRQCPVDGKWQAWGVWGSCTTTCGGGTQRRDRVCYGPFFGGETCQGPKEEYRQC
NDRKCPEPHEICDEESLASVVWKETPAGDAAAVRCPRNATGLILRRCTLDEEGIAYWEPP
TYVKCVSIDYRNIQMMTREHLSKAQRGLMGDGLSEVLQNLVEISQDGTSYSGDLLSTIDV
LRNMTEIFRRAYHSPTSGDVQNFVQIISNILSEENRDKWEEAQLIGPNAKELFRLVEDFI
DVIGFRMKDFRDSYQVTDNLVLGIHKLPANAATDITFPMKGWRGMVDWAKNSEDKVTVSK
SILSSGLTEMDDSSVFVVGTVLYRNVGNILSLQRNSTVLNSRVISVTVKPFPRSLLTPLE
IEFSHLYNGTTNQTCILWDGTDRNREPDENPSLWLRQIKCPQSFGFDQELLLYRGKKPTE
A
NT seq 1806 nt   +upstreamnt  +downstreamnt
atgagcagcgatgcagcactcctgaaccaggatccaaatgaccttcaggaacgggcagct
gctgctttccgaaatgtgaatggggaacaagggacgcactccaagcattcaaggggctgt
cagctctgcttctctcggctgctcagcttcaacgaaatgctcattttgcagagtacagag
gaaaaggaggccaaagagaaaggagggagcaaaagaaaagcgctggcggagaaaaaaaag
tgcatgcacggcacctgggatgagtggtctccatggagcctctgctcttccacctgtggg
agagggtacagggatcggacccgcacatgcaagcccccacaatttggtgggaacccctgc
gaaggccctgagaagcaaacgaagttctgcaacattgcactttgcccagtggacggcaac
tggaatgagtggtcgagctggagctcctgctccgcttcctgctccaacggcacccagcag
cggacgagggaatgcaatggaccttcctatgggggagctgaatgccaaggacattgggta
gagacccgggactgcttcctacgtcaatgcccagtggatgggaaatggcaagcttgggga
gtgtgggggagctgcaccactacatgtggaggtgggactcagagacgtgaccgtgtgtgt
tatggacccttctttggaggagagacctgccagggtcccaaagaagagtataggcagtgc
aacgacaggaagtgtcctgagccccatgagatctgtgatgaggaaagtcttgcctctgtg
gtttggaaagagacgcctgctggggatgctgcagctgttcggtgtcctcgcaatgccact
gggctaatccttcgaagatgcactttagatgaagaagggatagcttattgggagcctcca
acatacgtcaagtgtgtttctattgattacaggaacatacagatgatgaccagggagcat
ctttccaaagctcagcgtggtttgatgggagatgggctgtcagaagtgctccaaaacctt
gtggaaatctcccaggatgggaccagctacagcggagacttgctgtccaccattgatgta
ctcaggaacatgacagagatcttccgtagggcatatcacagtccaacttctggagatgtg
cagaactttgtccagatcatcagcaacattttatcggaagaaaaccgggacaagtgggag
gaagctcagctgatagggccaaatgccaaggagttgttcaggcttgtggaggatttcatt
gatgtcattggctttcgcatgaaggatttccgggattcctaccaagtgacggacaatctg
gtccttggcattcacaagctgcccgctaacgcagcaactgacatcactttccctatgaaa
ggctggagaggcatggtggactgggccaagaattcggaagacaaggtcactgtctccaag
agcatcctgtcttcagggctgacagagatggatgactcttctgtcttcgtggtagggact
gtgctgtaccggaacgtgggcaacatcctctcgctccagaggaacagcactgttctgaac
tccagagtaatctctgtgactgtgaagccatttccccggtccctcctcacccctttggaa
attgaattctcccacctgtacaatggaactaccaaccagacctgcatcctgtgggatgga
actgatagaaacagagaacctgatgagaacccttctctttggttgagacagataaaatgt
cctcaatcttttggatttgaccaggagctgctgctttatagagggaaaaagccaaccgaa
gcatga

DBGET integrated database retrieval system