KEGG   Meleagris gallopavo (turkey): 100540601
Entry
100540601         CDS       T01523                                 

Gene name
GADD45A
Definition
(RefSeq) growth arrest and DNA damage-inducible protein GADD45 alpha
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp04010  MAPK signaling pathway
mgp04068  FoxO signaling pathway
mgp04110  Cell cycle
mgp04115  p53 signaling pathway
mgp04210  Apoptosis
mgp04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100540601 (GADD45A)
   04068 FoxO signaling pathway
    100540601 (GADD45A)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100540601 (GADD45A)
   04210 Apoptosis
    100540601 (GADD45A)
   04115 p53 signaling pathway
    100540601 (GADD45A)
   04218 Cellular senescence
    100540601 (GADD45A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mgp03036]
    100540601 (GADD45A)
Chromosome and associated proteins [BR:mgp03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     100540601 (GADD45A)
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     100540601 (GADD45A)
SSDB
Motif
Pfam: Ribosomal_L7Ae
Other DBs
NCBI-GeneID: 100540601
NCBI-ProteinID: XP_003208967
Ensembl: ENSMGAG00000011990
LinkDB
Position
10
AA seq 142 aa
MEQAGDALEEVLSKALSQRSLTLGVYEAAKLLNVDPDNVVLCLLAADEEEEGDAALQIHF
TLIQAFCCENDINILRVSNPARLAQLLLPDGGPEPPTDLHCVLVTNPHASQWKDPALSQL
MCFCRESRYMDQWVPVINLPER
NT seq 429 nt   +upstreamnt  +downstreamnt
atggagcaggcgggggacgcgctggaggaggtgctgagcaaggcgctgagccagcggagc
ctcaccctgggtgtctacgaggcggccaagctgctcaacgttgaccccgacaacgtggtt
ttgtgcctcctggccgccgacgaggaagaagaaggagacgcggcgctgcaaatccacttc
accttaatccaagctttctgctgcgagaacgacatcaacatcctgcgggtcagcaacccg
gctcgcttggcccagttgttgcttcccgacggcggtcctgaaccacccactgatctccat
tgcgtcttggtcacgaatccccacgcctcccaatggaaggatccagcgctgagtcagctg
atgtgcttctgccgggagagtcgctacatggatcagtgggtgccggtgatcaacctcccc
gagcggtga

KEGG   Meleagris gallopavo (turkey): 104915137
Entry
104915137         CDS       T01523                                 

Gene name
GADD45G
Definition
(RefSeq) growth arrest and DNA damage-inducible protein GADD45 gamma
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp04010  MAPK signaling pathway
mgp04068  FoxO signaling pathway
mgp04110  Cell cycle
mgp04115  p53 signaling pathway
mgp04210  Apoptosis
mgp04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104915137 (GADD45G)
   04068 FoxO signaling pathway
    104915137 (GADD45G)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    104915137 (GADD45G)
   04210 Apoptosis
    104915137 (GADD45G)
   04115 p53 signaling pathway
    104915137 (GADD45G)
   04218 Cellular senescence
    104915137 (GADD45G)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mgp03036]
    104915137 (GADD45G)
Chromosome and associated proteins [BR:mgp03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     104915137 (GADD45G)
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     104915137 (GADD45G)
SSDB
Motif
Pfam: Ribosomal_L7Ae
Other DBs
NCBI-GeneID: 104915137
NCBI-ProteinID: XP_010724155
LinkDB
Position
Z
AA seq 159 aa
MTLEETQGQQPVPASEDWMQGAGKALHELLVSAQRRGCLTAGVYESAKLMNVDPDNVAFC
VLAADEEDEGDIALQIHFTLIQAFCCENDIDIVRVSDLPKLAAAVGSSEESGEPRDLHCI
LITNPNEDAWKDPALEKLNSFCEESRNINEWVPTIALPE
NT seq 480 nt   +upstreamnt  +downstreamnt
atgactctggaagagacgcagggacagcagccggtgcccgcgagcgaggactggatgcag
ggcgccggcaaggccctccacgagctgctggtatcggcgcagcgccgcggctgcctcacc
gccggcgtctacgagtcggccaagcttatgaacgtagacccagataacgtggcgttctgc
gtgttggcggccgatgaggaggatgagggggacatcgccctgcagatccacttcaccctc
atccaagccttctgctgcgagaacgacatcgacatcgtgcgtgtgagtgatctacccaag
ctggccgctgccgtgggatccagcgaggagtctggcgagcccagagacctgcactgcatc
ctcatcacgaacccaaatgaagatgcctggaaggacccagctctagagaagctgaactct
ttctgtgaagaaagccggaacatcaatgagtgggtgccaactattgctttacctgagtga

DBGET integrated database retrieval system