KEGG   Meleagris gallopavo (turkey): 100540699Help
Entry
100540699         CDS       T01523                                 

Gene name
LCT
Definition
(RefSeq) lactase
  KO
K01229  lactase-phlorizin hydrolase [EC:3.2.1.108 3.2.1.62]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp00052  Galactose metabolism
mgp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    100540699 (LCT)
Enzymes [BR:mgp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.62  glycosylceramidase
     100540699 (LCT)
    3.2.1.108  lactase
     100540699 (LCT)
Chaperones and folding catalysts [BR:mgp03110]
 Intramolecular chaperones
  Others
   100540699 (LCT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_1
Motif
Other DBs
NCBI-GeneID: 100540699
NCBI-ProteinID: XP_010712328
Ensembl: ENSMGAG00000012487
LinkDB All DBs
Position
7
AA seq 1919 aa AA seqDB search
MELVCKTVVFFLLVSTSFGIDGELAQDFVAIAGPLPTTLVHRLHLQSHVLPKEALDPTMS
EARDDFCQQDTVISQLLQYFSHLREIGVTHYKVFLPWARILPDGDAKKPDEAQVRCYQEL
LKMLVAADLRPVVVLHHKGVPDSVAVGRKASSFADLFVDYAEFSFYVFGGLADMWLTFSD
LPELLGSLPYSDPQVRVQALASAHERAYSVYHEKYSVSGGKLSIALGMDLILDRTSSELL
SVSLQDSVDFLSLSLQYRCGNETDFYLKMSEFQEVWKDIEVLLFSIKFLDCDSLEENPFI
PVAAIVTALNKEKARTIGYDVNEFLDFSSHVSSKTYTLQENPIAAPRSSYQTVWEMFANQ
SELERDTFLQDVFPSGFLWGTSTGAFNIEGAWAEDGKGESIWDQFGHEGHVYMNQTTDVA
CDSYHKTSYDVYLLRGLHPQLYKFSISWPRIFPAGTNETISIKGVDYYNQLIDRLLEANI
EPMVTLFHWDLPQALQVLGGWQNDSIIDAFANYADFCFATFGDRVKFWVTFHEPWVISYA
GYGTGEHPPGITDPGIASYKVAHTILKAHAKVWHLYNDRYRSQQQGRVGLVLNSDWAEPQ
TPTNSEDVKASERYLQFMLGWFAHPVFVNGDYPDILKAQIQEVNQQCSNTVAQLPVFTEE
EKTWVKGTADFFGLSHYTSHLVSAVTNDTCIPGYESIGNFSLHVDPSWPKTASFSIHVVP
WGLRRLLKFVSQEYTGAKIPIYIAGNGMPTEATGDLINDTLRVDYFRRYINEALKAVKLD
AVDVQSYIARSLVDGFEGPGGYSLKFGLHHVNFEDSNRPRTPRASAYFYSSVIENNGFPS
KVSDRSSASVVFGLPTPSKLPSLPASEVPSKSKVVWEKFSSQTDFERDMYFYGTFPEDFT
WGVSSSAYQIEGGWDADGKGPSVWDNFTHVPGNIKNNDTGDIACNSYNKVEEDIYLLRAL
GVKNYRFSLSWPRIFPNGRNNSINSHGVDYYNHLIDGLVANNITPIVTLYHWDLPQALQD
IGGWENSELIELFDSFADFCFQTFGDRVKFWLTFNEPYVIAWVSYGIGEFPPNVNNPGGA
PYEVAHTLLKAHARVYHTYDDKYRASQGGVISLCFNIDWIEPKTPSDPRDLEAADRYMQF
LVGWFAHPVFKNGDYPEVMKWKVGNRSELQNLPSSRLPVFTAEEREYIRGTADVFCFNTY
TAKLVTHATTRLNPFSYEYDQEISTDVDSSWPTSALAGHRAVAWGLRRLLNWVKEEYGNP
PMYIIENGVGLKTESDVDDQTRILYYKTYIDEALKAYKLDGVNLRGYNAWSFLDSFEWLN
GYEPRFGLHEVDFDDPNRPRTPRRSAVYYAEIIRNNGIPLPKEDEFLYGEFPKNFCWSVA
TAAYQIEGAWRADGKGLSIWDKYTHTPLKISNDANGDVACDSYHKIEEDVEMLKRLKVSH
YRFSISWSRVLPDGTTRYVNEMGLNYYERLIDALLAANITPQVTLYHWDLPQALQDNGGW
ENDTIIQRFKEYAELLFQRLGDKVKFWITLNEPYNTAYLGYGFGTAAPGISVRPGRAPYV
VGHNLIKAHAEAWHLYNETYRAKQGGLISITINSDWAEPRNPHKQEDFEAARQYLQFLIG
WFAHPIFKNGDYNEVMKTRIRERSLAQGLSSSRLPEFTESEKQRIKGTYDYFGLNHYTTV
LTYKYEYSTGILSYDADRGVASVTDRSWLNSGSFWLKVTPFGFRKLLRWIKEEYNNPPIY
VTENGISERGAVDFNDTWRIHYHRNYINEALKAVVLDGVDLRGYTAWTLMDNFEWAVGFD
EKFGFYHVNYTDPTLPRLPKASARYYSQIISCNGFLDPATGPHPCLETEPEVIPDTTPGL
ADSVRFLGLDLTSHSAEIALYVLFALSGIGALGLALISYKYGTLSKRSHKQSSMELSKM
NT seq 5760 nt NT seq  +upstreamnt  +downstreamnt
atggagctggtttgtaagacagttgtctttttcttgttagtctctactagctttgggata
gatggggaattagctcaggactttgttgccattgctggacctctgcctaccacattagtg
cacagactgcatctgcagagccacgttctacccaaagaagctttggaccctactatgtct
gaagcccgtgatgacttctgtcagcaagatactgtgatttcccaactgctccagtacttc
tcccacctccgtgagattggggtaacacattacaaagtcttcctgccatgggcacgcatt
cttcctgatggggacgccaagaagccagacgaagctcaagtgcgatgctaccaggagctg
ctcaaaatgctggttgctgcagacctcaggccagtggttgttctccatcacaagggtgtt
cctgacagtgtggctgtaggcaggaaggcgagctcttttgctgacctttttgtggattat
gcagagttcagtttctatgtttttgggggcctggctgatatgtggctcaccttcagtgac
ctgcctgagctcctgggaagcctgccttacagtgacccccaggtccgtgtccaggccctg
gcttctgctcatgaaagagcttacagtgtttaccatgagaaatactctgtgtcaggtgga
aagctgtccattgctttaggaatggatcttatcttggataggacttcatctgagttgctt
tcagtttctcttcaggattcagtagacttcctgtctcttagccttcagtacaggtgtgga
aatgaaacagatttctacctgaaaatgagtgaattccaggaagtctggaaggacatagaa
gtattgctttttagtataaagttccttgactgtgattccttggaagagaatccattcata
ccagtggctgccattgtcactgctcttaataaagagaaggcacgtacaattggatatgat
gtgaatgaattcttggacttctcatctcatgtttcaagcaaaacatatactctacaagag
aatccaattgctgcccctcgctcctcctatcaaacagtttgggaaatgtttgctaaccag
tctgaattggagagggatactttcctgcaagatgttttcccaagtggtttcctctggggc
acgtccacaggtgcctttaatattgaaggagcctgggcagaggatgggaaaggagagagc
atctgggatcagtttgggcatgaaggtcatgtctacatgaaccaaacaacagatgtggca
tgtgacagctaccataaaaccagctatgatgtttatttgcttagaggtcttcatccccag
ctgtacaagttttctatatcctggcctagaattttccctgctggcaccaatgaaaccatc
agcatcaagggtgtggattattataaccaattaattgacaggttgctagaggctaacatt
gagcccatggtgactcttttccactgggacctcccccaggctcttcaggttcttggtggc
tggcagaatgacagtatcatagatgcttttgcaaactacgcagacttctgctttgccact
tttggggatcgggtcaagttttgggttacgttccacgagccttgggttatcagctatgct
ggctatggcaccggagagcatcctccaggaatcactgatccaggaatagcatcttacaag
gtggctcacacaattctcaaggctcatgctaaggtctggcacctgtataatgacagatac
cgttctcagcagcagggaagggtagggctggtgctgaactcggattgggctgaaccccag
actccaaccaactctgaggatgtgaaggcatcagagaggtacctgcagttcatgcttggc
tggtttgctcaccctgtatttgttaacggtgactatccagatatcctgaaggctcagatc
caggaagtaaaccagcagtgctccaacacagttgcacagctgcctgtgtttacggaggag
gagaaaacctgggtgaaaggaacggcagacttttttggcctttcccattacacttcccac
ctggttagtgccgtgactaatgatacctgcatacctggatatgaaagcattgggaacttc
tctttgcacgtagatccttcgtggccaaagactgcctctttttcaatccatgtggtcccg
tggggattaagaaggctgctgaagtttgtgtcccaggaatatacaggggcaaagatccca
atttacatagcaggaaatggtatgccgacagaagccacaggggatcttattaatgacact
ctgcgagtggattatttccgccgatacatcaatgaggctctaaaagcggtaaaactagac
gcagttgatgttcagtcatatattgctcgatccctggttgatggctttgaaggcccaggg
ggttacagcctaaaatttgggctacatcatgtgaattttgaagatagcaacagaccaagg
actcccagggcaagtgcttatttctattccagtgttattgaaaacaatggtttcccatcc
aaagtctcagacagaagttctgcgtcggtggtatttggcctacccacaccatcaaagttg
ccgagtctaccagcatcagaagttccctccaagtcaaaagttgtctgggagaagttttca
tcccaaacagactttgaaagagacatgtacttttatgggacgttcccagaggactttaca
tggggtgtgtcatcttctgcataccagattgaaggaggttgggatgcggatggcaaagga
cccagtgtttgggataacttcacccatgtaccaggaaacataaaaaacaatgacactgga
gatatagcttgtaatagctacaacaaggtagaggaagatatttacctgctgagagcctta
ggggtaaagaactatcgtttctctctgtcctggcctcgaatcttccccaacggaaggaac
aattcaataaacagccatggtgttgattactataaccatctcattgatgggctggtcgca
aacaacatcactccaatcgtcaccctgtaccactgggacctgccacaagctctccaggac
attggtggctgggagaacagtgagctcattgaactgtttgacagttttgcagacttctgt
ttccagacctttggggacagggtgaagttctggcttacattcaatgaaccctacgttatt
gcttgggttagttatgggataggggaatttccacccaatgtcaataatcctggtggtgct
ccctatgaagtggcacacaccttactgaaagctcacgccagagtctaccacacatacgat
gacaaatacagagcgagtcagggaggagtcatttctctgtgtttcaatattgattggatt
gagccaaagacaccaagcgaccccagggacctagaagctgcagacaggtacatgcagttt
ttggtggggtggtttgcacatccagttttcaaaaatggggactaccctgaagtcatgaaa
tggaaagttggaaacaggagtgagctccaaaacctgccgtcatcccgcctaccggttttc
acagctgaagagcgtgagtacatcaggggcacagcggatgttttctgtttcaacacctac
actgccaaacttgtaacccatgcaacaacccgactgaatcccttctcttatgagtatgac
caggaaatatcaacagatgttgacagctcctggcctacctcagctcttgctggccatcgg
gctgtggcttgggggctgaggaggctgctgaactgggtcaaagaagagtatggaaatcct
ccaatgtacatcattgagaacggagtggggctaaagaccgaatcggatgttgatgaccaa
accaggatactttactacaaaacgtacatagatgaagctttaaaagcttacaagctggac
ggtgttaatctgagaggatacaatgcttggtcttttctggattcctttgaatggttgaat
ggttatgagccaagatttggattgcacgaggttgattttgatgatcccaacaggccaaga
accccaaggcgctcggctgtgtactatgcagaaatcattcgcaacaatggtatcccattg
ccaaaagaagatgaatttttatatggggagtttccaaagaacttttgctggagtgtagca
acagctgcatatcagattgagggagcatggagagcagatgggaaaggacttagcatttgg
gacaaatacactcacactcctttgaaaatcagcaatgatgccaatggagatgtagcttgt
gacagctaccacaagattgaggaggatgtggaaatgctgaaacgcctcaaggtgtctcac
tatcgcttttcaatctcctggtcacgtgttctcccagatgggaccaccagatacgtcaat
gaaatgggattgaactactatgaaaggctaattgatgctcttctggcagccaatattaca
cctcaggtcactctctatcactgggacctcccacaggcactgcaggacaacggtgggtgg
gagaatgataccataattcagaggtttaaggaatatgctgagctccttttccagagattg
ggagacaaagtgaaattttggataaccctcaatgaaccctacaacactgcatatcttggg
tatggctttggcacagctgctccaggtatctctgttagacctgggcgagccccctatgtg
gtggggcacaacctcatcaaggcccatgcagaagcctggcacctgtacaatgagacttac
cgtgcgaaacaaggaggactgatctctatcaccatcaactctgactgggctgagccaagg
aacccacacaaacaggaggattttgaagctgccagacaatacttgcagttccttataggt
tggtttgctcatcccattttcaaaaacggcgattataatgaagtgatgaaaacgaggatt
cgggaacgcagcctggcccagggtctgagcagctcccgacttccagaatttacagaaagt
gaaaagcaaagaattaaaggcacatatgactactttggtctaaatcattatactacagtt
ttaacatacaagtatgagtattctactggtattctatcgtatgatgctgacaggggtgtt
gcttcagtaaccgaccgcagctggctgaactctggttccttctggctaaaggtgacaccc
tttggcttccgaaagctcctgaggtggataaaggaagagtacaacaaccctcctatttat
gtgactgaaaatgggatatcagagaggggagccgtagatttcaatgacacttggcgaatc
cattaccatcggaactacattaacgaagcgctgaaagctgttgtgcttgatggcgttgac
ctgcgcggctacacggcatggacactgatggacaactttgagtgggcagtgggctttgat
gaaaagtttgggttctaccatgtgaattacacagatcccacattgccacggctccccaag
gcctctgccaggtactactcccagatcatcagctgcaatggctttctagatcctgcaaca
ggcccacatccctgtctggaaacggagcctgaagtgataccagacaccacaccaggactg
gctgacagtgtgcgctttctgggattagatttaacatcacacagtgcagaaatagcactg
tatgtgctttttgctctttctggaattggagcactgggcctggcacttatttcatataaa
tatggaacattatccaaaagatctcataagcaatcatccatggaacttagtaaaatgtaa

DBGET integrated database retrieval system